Download Tesis Isabel Ochando - Micol and Ponce labs

Document related concepts

Desarrollo vegetal wikipedia, lookup

Embriogénesis vegetal wikipedia, lookup

Meristemo wikipedia, lookup

Physcomitrella patens wikipedia, lookup

Arabidopsis thaliana wikipedia, lookup

Transcript
Departamento de Biología Aplicada
División de Genética
Estudio de nuevos mutantes que alteran
la actividad del meristemo y la polaridad
adaxial-abaxial en Arabidopsis thaliana
Isabel Ochando Sánchez
San Juan de Alicante, 2005
Estudio de nuevos mutantes que alteran la actividad del
meristemo y la polaridad adaxial-abaxial en Arabidopsis
thaliana
Trabajo realizado en la División de Genética del Departamento de Biología Aplicada de la
Universidad Miguel Hernández de Elche, para optar al Grado de Doctor, por la Licenciada
Isabel Ochando Sánchez.
San Juan de Alicante, 31 de mayo de 2005
Departamento de Biología Aplicada
Universidad Miguel Hernández – Campus de Sant Joan d’Alacant
ANTONIO MARTÍNEZ LABORDA, Profesor Titular de Genética de la Universidad Miguel
Hernández de Elche,
CERTIFICA
que la Licenciada Dña. Isabel Ochando Sánchez ha realizado bajo su dirección y
supervisión la Tesis Doctoral que con el título Estudio de nuevos mutantes que alteran la
actividad del meristemo y la polaridad adaxial-abaxial en Arabidopsis thaliana presenta para
optar al Grado de Doctor. El trabajo reflejado en la presente memoria se ha desarrollado
íntegramente en la División de Genética de la Universidad Miguel Hernández de Elche.
Y para que así conste y surta a los efectos oportunos, firmo el presente certificado en Sant
Joan d’Alacant a 31 de mayo de 2005
Fdo.: Dr. Antonio Martínez Laborda
Universidad Miguel Hernández, Campus de Sant Joan, Ctra. Alicante-Valencia Km. 87, 03550 San Juan, Alicante. Spain
Tel: 34 96 591 9476 – Fax: 34 96 591 9568 – e-mail: [email protected] – URL: http://biolapli.umh.es
Departamento de Biología Aplicada
Universidad Miguel Hernández – Campus de Elche
Prof. Dr. D. José Luis Micol Molina, Catedrático de Universidad y director del Departamento
de Biología Aplicada de la Universidad Miguel Hernández de Elche,
INFORMA
Que la Tesis Doctoral titulada Estudio de nuevos mutantes que alteran la actividad del meristemo y
la polaridad adaxial-abaxial en Arabidopsis thaliana ha sido realizada por la licenciada Dña.
Isabel Ochando Sánchez, bajo la inmediata dirección y supervisión del Prof. D. Antonio
Martínez Laborda, y que el Departamento de Biología Aplicada ha dado su conformidad para
que sea presentada ante la comisión de doctorado.
Elche, a 31 de mayo de 2005
Fdo.: José Luis Micol Molina
Universidad Miguel Hernández, Campus de Elche, Edificio Vinalopó, Avenida del Ferrocarril s/n, 03202 Elche, Alicante. Spain
Tel: 34 96 665 8504 – Fax: 34 96 665 8511 – e-mail: [email protected] – URL: http://biolapli.umh.es
A mi familia
A Miguel
Índices I
Índice de Materias
Índice de Figuras ................................................................................................ VII
Índice de Tablas ................................................................................................... IX
I.- Introducción ....................................................................................................... 1
I.1.- El desarrollo vegetal ........................................................................................... 2
I.2.- Utilización de los sistemas modelo en el estudio del desarrollo ......................... 4
I.3.- Arabidopsis thaliana como sistema modelo en el estudio del
desarrollo vegetal ............................................................................................... 5
I.4.- Singularidades de Arabidopsis thaliana.............................................................. 6
I.5.- Estructura corporal de Arabidopsis thaliana ....................................................... 8
I.6.- Desarrollo de Arabidopsis thaliana ................................................................... 10
I.6.1.- Desarrollo embrionario.............................................................................. 10
I.6.2.- Origen y estructura de los meristemos radicular y apical.......................... 11
I.6.2.1.- Genes implicados en la formación y el mantenimiento
del meristemo apical ......................................................................... 13
I.6.3.- El desarrollo postembrionario ................................................................... 14
I.6.3.1.- El desarrollo del tallo ......................................................................... 15
I.6.3.1.1.- Diferenciación del sistema vascular........................................... 16
I.6.3.1.2.- Papel de las hormonas vegetales en la formación
del patrón vascular..................................................................... 17
I.6.3.2.- El desarrollo de la hoja ...................................................................... 19
I.6.3.3.- El desarrollo de los órganos florales ................................................. 21
I.6.3.4.- El desarrollo del fruto......................................................................... 24
I.6.4.- El establecimiento de la polaridad en los órganos laterales ..................... 26
I.6.5.- Los genes HD-ZIP..................................................................................... 30
I.6.5.1.- Función de los genes HD-ZIP de Arabidopsis thaliana ..................... 31
I.6.5.2.- La familia de genes HD-ZIP III .......................................................... 32
I.6.6.- La regulación post-transcripcional mediada por microRNA ...................... 33
II.- Antecedentes y objetivos........................................................................ 36
Índices II
III.- Materiales y métodos ............................................................................... 40
III.1.- Organismos utilizados en este trabajo............................................................ 41
III.1.1.- Estirpes de Arabidopsis thaliana ............................................................. 41
III.1.1.1.- Estirpes silvestres............................................................................ 41
III.1.1.2.- Estirpes mutantes............................................................................ 41
III.1.1.2.1.- Nomenclatura utilizada en la denominación
de genes, mutaciones y fenotipos ........................................... 41
III.1.1.2.2.- Procedencia de las estirpes mutantes ..................................... 42
III.1.2.- Estirpes de Escherichia coli .................................................................... 43
III.1.3.- Estirpes de Agrobacterium tumefaciens ................................................. 43
III.2.- Vectores. Plásmidos y construcciones ........................................................... 43
III.3.- Oligonucleótidos empleados como cebadores ............................................... 44
III.4.- Medios de cultivo, disoluciones y tampones................................................... 46
III.4.1.- Medios de cultivo .................................................................................... 46
III.4.1.1- Medios de cultivo para Arabidopsis thaliana .................................... 46
III.4.1.1.1.- Medio de cultivo líquido ........................................................... 46
III.4.1.1.2.- Medio de cultivo sólido............................................................. 46
III.4.1.2.- Medios de cultivo para microorganismos ........................................ 47
III.4.1.2.1.- Medio de cultivo líquido ........................................................... 47
III.4.1.2.2.- Medio de cultivo sólido............................................................. 47
III.4.1.3.- Medios de cultivo con antibióticos ................................................... 47
III.4.2.- Disoluciones y tampones ........................................................................ 47
III.4.2.1.- Disoluciones de uso común............................................................. 47
III.4.2.2.- Disoluciones para el aislamiento de DNA genómico
de Arabidopsis thaliana.................................................................... 48
III.4.2.3.- Disoluciones empleadas en el aislamiento de DNA plasmídico ...... 48
III.4.2.4.- Disoluciones utilizadas en electroforesis ......................................... 48
III.4.2.5.- Disoluciones empleadas en la identificación
de clones bacterianos mediante hibridación.................................... 48
III.4.2.6.- Disoluciones utilizadas en la hibridación in situ de tejidos .............. 49
III.4.2.7.- Disolución para la infiltración de plantas
con Agrobacterium tumefaciens ...................................................... 49
III.4.2.8.- Disolución de esterilización de semillas de Arabidopsis thaliana .... 49
III.4.2.9.- Sustrato para cultivo de Arabidopsis thaliana en maceta................ 50
Índices III
III.5.- Condiciones y métodos de cultivo .................................................................. 50
III.5.1.- Condiciones y métodos de cultivo para Arabidopsis thaliana ................. 50
III.5.1.1.- Cultivos en placas de Petri .............................................................. 50
III.5.1.2.- Cultivos en maceta .......................................................................... 50
III.5.1.3.- Realización de cruzamientos........................................................... 51
III.5.2.- Condiciones y métodos de cultivo para Escherichia coli
y Agrobacterium tumefaciens .................................................................. 51
III.6.- Estudio de las características morfológicas e histológicas ............................. 52
III.6.1.- Fotografía a bajo aumento ...................................................................... 52
III.6.2.- Microscopía óptica .................................................................................. 52
III.6.2.1.- Inclusión en resina JB4 ................................................................... 52
III.6.2.2.- Inclusión en parafina ....................................................................... 53
III.6.3.- Microscopía electrónica de barrido (SEM) .............................................. 54
III.7.- Aislamiento y manipulación de ácidos nucleicos ............................................ 54
III.7.1.- Preparaciones de DNA genómico de Arabidopsis thaliana..................... 54
III.7.2.- Preparaciones de DNA plasmídico ......................................................... 55
III.7.3.- Tratamiento de DNA con enzimas de restricción .................................... 55
III.7.4.- Reacciones de ligación de DNA.............................................................. 55
III.7.5.- Técnicas electroforéticas ........................................................................ 56
III.7.5.1.- Electroforesis en geles de poliacrilamida (PAGE)
en condiciones desnaturalizantes.................................................... 56
III.7.5.2.- Electroforesis en geles de agarosa
en condiciones no desnaturalizantes............................................... 56
III.7.6.- Recuperación de DNA a partir de geles de agarosa............................... 56
III.7.7.- Amplificación de DNA mediante la reacción en cadena
de la polimerasa (PCR) ........................................................................... 56
III.7.8.- Secuenciación de DNA ........................................................................... 57
III.7.9.- Análisis y tratamiento informático de las secuencias
de ácidos nucleicos y proteínas............................................................... 57
III.8.- Técnicas de hibridación molecular de ácidos nucleicos ................................. 58
III.8.1.- Identificación de clones bacterianos mediante hibridación en colonia.... 58
III.8.1.1.- Obtención de la sonda marcada...................................................... 58
III.8.1.2.- Transferencia del DNA a una membrana de nailon......................... 58
III.8.1.3.- Tratamientos de prehibridación, hibridación con la sonda
y lavado de la membrana ............................................................... 59
III.8.1.4.- Detección colorimétrica de la señal................................................. 59
Índices IV
III.8.2.- Análisis de la expresión mediante hibridación in situ
en tejidos vegetales ................................................................................. 60
III.8.2.1.- Obtención de ribosondas marcadas con digoxigenina .................... 60
III.8.2.2.- Cuantificación del rendimiento del marcaje..................................... 60
III.8.2.3.- Obtención y procesamiento histológico de las muestras................. 61
III.8.2.4.- Prehibridación e hibridación de la sonda......................................... 61
III.8.2.5.- Lavados e inmunodetección colorimétrica de la señal .................... 62
III.9.- Transformación bacteriana ............................................................................. 62
III.9.1.- Transformación por choque térmico........................................................ 62
III.9.2.- Transformación por electroporación........................................................ 62
III.10.- Transformación de Arabidopsis thaliana....................................................... 63
III.10.1.- Obtención de las construcciones de sobreexpresión............................ 63
III.10.2.- Obtención de la construcción de interferencia ...................................... 64
III.10.3.- Infiltración con Agrobacterium tumefaciens .......................................... 64
III.10.4.- Selección de los transformantes ........................................................... 66
III.11.- Cartografía génica mediante análisis de ligamiento a marcadores SSLP .... 66
III.12.- Genotipado molecular de los alelos icu4 ...................................................... 66
III.13.- Tratamientos con auxinas y con inhibidores de su transporte...................... 67
III.14.- Análisis estadístico mediante χ2 ................................................................... 67
IV.- Resultados ..................................................................................................... 69
IV.1.- Caracterización fenotípica de los mutantes icu4-1 e icu4-2 ........................... 70
IV.1.1.- Morfología foliar ...................................................................................... 70
IV.1.2.- Estructura corporal ................................................................................. 72
IV.1.3.- Morfología de los órganos florales.......................................................... 75
IV.1.4.- Morfología del patrón vascular en la inflorescencia................................ 75
IV.1.5.- Desarrollo embrionario ........................................................................... 77
IV.2.- Caracterización fenotípica del doble mutante icu4-1 hst-1............................. 78
IV.3.- Obtención de dobles mutantes con otros genes implicados en el
establecimiento del eje adaxial-abaxial .......................................................... 81
IV.4.- Caracterización molecular del gen ICU4 ........................................................ 82
IV.4.1.- Estructura del gen ICU4 ......................................................................... 84
IV.4.2.- Obtención de plantas transgénicas ........................................................ 86
IV.4.2.1.- Sobreexpresión de los cDNA silvestre y mutante
del gen ICU4 en las plantas silvestres En-2................................... 86
Índices V
IV.4.2.2.- Sobreexpresión de una construcción de interferencia
en las plantas homocigotas icu4-1/icu4-1 ...................................... 88
IV.4.3.- Análisis de la expresión del gen ICU4 .................................................... 90
IV.5.- Análisis de las interacciones genéticas entre ICU4 y otros
miembros de la familia HD-ZIP III ................................................................... 91
IV.5.1.- Obtención de alelos de pérdida de función ............................................ 91
IV.5.2.- Análisis de los dobles mutantes icu4 athb8 ............................................ 91
IV.5.3.- Análisis de los dobles mutantes icu4-1 rev............................................. 92
IV.5.4.- Análisis de los dobles mutantes icu4-1 phb1-d ...................................... 93
IV.6.- Análisis de los dobles mutantes icu4-1 fil-3.................................................... 94
IV.7.- Estudio de la función del gen ICU4 en la filotaxia .......................................... 95
IV.7.1.- Análisis del patrón de filotaxia de los dobles mutantes
icu4-1 pny-40126 ..................................................................................... 96
IV.7.2.- Análisis del patrón de filotaxia de los dobles mutantes
icu4-1 bp-1 ............................................................................................... 97
IV.8.- Estudio de la función del gen ICU4 en el desarrollo vascular ........................ 97
IV.8.1.- Análisis del patrón vascular de los dobles mutantes icu4-1 phb-1d ....... 98
IV.8.2.- Análisis del patrón vascular de los dobles mutantes icu4 hst-1.............. 98
IV.8.3.- Análisis del patrón vascular de los dobles mutantes phb-1d hst-1 ......... 98
IV.8.4.- Análisis del patrón vascular de los dobles mutantes icu4-1 fil-3............. 99
IV.8.5.- Análisis del patrón vascular de los dobles mutantes icu4-1 rev ............. 99
IV.8.6.- Análisis del patrón vascular de las plantas transgénicas
35S:ICU4 y 35S:ICU4-G189D ............................................................... 101
IV.8.7.- Efectos de las auxinas y de los inhibidores de su transporte
en el desarrollo del patrón vascular ....................................................... 102
V.- Discusión ....................................................................................................... 104
V.1.- icu4-1 e icu4-2 son dos alelos semidominantes del gen ICU4...................... 105
V.2.- El gen ICU4 codifica un producto con función adaxial .................................. 106
V.3.- El gen ICU4 codifica el factor de transcripción ATHB15,
perteneciente a la familia HD-ZIP III ............................................................. 108
V.4.- Una mutación puntual en el sitio de unión del miRNA165/166
causa la sobreexpresión del gen ICU4 ......................................................... 110
V.5.- Los alelos de pérdida de función de ICU4 no muestran fenotipo mutante.... 111
V.6.- ICU4 participa en la formación del patrón radial del tallo .............................. 112
Índices VI
V.6.1.- ICU4 promueve la diferenciación de los tejidos vasculares................... 112
V.6.2.- ICU4 participa en la formación del patrón en la eustela ........................ 113
V.6.3.- ICU4 participa en la formación del patrón interno de los
haces vasculares ................................................................................... 115
V.6.4.- La participación de ICU4 en la formación del patrón radial
del tallo incluye también a tejidos no vasculares ................................... 116
V.6.5.- Relación entre el flujo polar de auxinas y la función del gen
ICU4 en la formación del patrón radial del tallo ..................................... 118
V.7.- Relaciones sinérgicas y antagónicas entre diferentes alelos
mutantes de miembros de la familia HD-ZIP III............................................. 121
V.8.- ICU4 participa en la formación del patrón de filotaxia e interacciona
con genes implicados en dicho proceso ....................................................... 124
VI.- Conclusiones ............................................................................................. 127
VII.- Bibliografía ................................................................................................. 130
Agradecimientos............................................................................................... 156
Índices VII
Índice de Figuras
Figura I.1.- Arabidopsis thaliana .................................................................................... 5
Figura I.2.- Representación esquemática del plan corporal de Arabidopsis thaliana .... 9
Figura I.3.- Establecimiento del plan corporal de Arabidopsis thaliana ....................... 10
Figura I.4.- Organización radial de los tejidos en la raíz de Arabidopsis ..................... 12
Figura I.5.- Estructura del meristemo apical de Arabidopsis ....................................... 13
Figura I.6.- Organización radial de los tejidos del tallo en Arabidopsis
y tipos de haces vasculares ....................................................................... 17
Figura I.7.- Morfología de la hoja ................................................................................. 20
Figura I.8.- Morfología de la flor de Arabidopsis .......................................................... 22
Figura I.9.- Revisión del modelo ABC.......................................................................... 23
Figura I.10.- Morfología del fruto de Arabidopsis......................................................... 24
Figura I.11.- Establecimiento de los ejes adaxial-abaxial y central-periférico ............. 30
Figura I.12.- Filograma de los miembros de la familia HD-ZIP III de Arabidopsis ....... 32
Figura III.1.- Plásmido pBIN-JIT................................................................................... 44
Figura III.2.- Esquemas de las construcciones transgénicas....................................... 65
Figura IV.1.- Fenotipo de las rosetas basales y de las hojas vegetativas
de plantas En-2 e icu4-1 .......................................................................... 71
Figura IV.2.- Cortes transversales de cotiledones de plántulas de 3 días................... 71
Figura IV.3.- Crecimientos anómalos en la superficie abaxial de hojas
vegetativas del mutante icu4-1 ............................................................... 72
Figura IV.4.- Alteración de la filotaxia de los mutantes icu4-1 ..................................... 73
Figura IV.5.- Meristemo apical del tallo de plántulas En-2 e icu4-1,
3 días después de la germinación .......................................................... 74
Figura IV.6.- Retraso en el tiempo de floración en los mutantes icu4-1 ...................... 74
Figura IV. 7.- Efectos de la mutación icu4-1 en la diferenciación vascular
de los tallos ............................................................................................. 77
Figura IV.8.- La mutación icu4-1 causa defectos en la embriogénesis ....................... 78
Figura IV.9.- Fenotipo de la roseta basal y las hojas vegetativas
de hst-1 y del doble mutante icu4-1 hst-1............................................... 79
Índices VIII
Figura IV.10.- Fenotipo del pistilo, del fruto y de los estambres de icu4-1,
hst-1 y del doble mutante icu4-1 hst-1 .................................................. 80
Figura IV.11.- Fenotipo de pistilos y silicuas de crc-1 y del doble
mutante icu4-1 crc-1.............................................................................. 82
Figura IV.12.- Estructura del gen ICU4........................................................................ 85
Figura IV.13.- Fenotipo de las plantas En-2 portadoras de la construcción
35S:ICU4 ............................................................................................... 88
Figura IV.14.- Fenotipo de las plantas En-2 portadoras de la construcción
35S:ICU4-G189D y de una planta icu4-1 con la construcción
de interferencia...................................................................................... 89
Figura IV.15.- Análisis de la expresión del gen ICU4 en tallos de inflorescencia de En2 y de icu4-1 mediante hibridación in situ ............................................. 90
Figura IV.16.- Localización de las inserciones de T-DNA de los alelos
icu4 y athb8 ........................................................................................... 92
Figura IV.17.- Fenotipos del doble mutante icu4-1 rev-1............................................. 93
Figura IV.18.- Disminución del fenotipo causado por la mutación
phb-1d en el doble heterocigoto ICU4/icu4-1;PHB/phb-1d ................... 94
Figura IV.19.- Fenotipo de fil-3 y del doble mutante icu4-1 fil-3 .................................. 95
Figura IV.20.- Fenotipo de pny-40126 y del doble mutante icu4-1 pny-40126 ............ 96
Figura IV.21.- Fenotipo de bp-1 y del doble mutante icu4-1 bp-1................................ 97
Figura IV.22.- Cortes transversales de tallos de inflorescencia de
algunos dobles mutantes que muestran un fenotipo alterado............. 100
Figura IV.23.- Cortes transversales de tallos de inflorescencia de plantas
transgénicas En-2 que sobreexpresan el cDNA silvestre de ICU4
y el cDNA mutante de icu4-1............................................................... 101
Figura IV.24.- Efectos de los tratamientos de plantas En-2 e icu4-1 con
NAA 1µM y NPA 40 µM....................................................................... 103
Índices IX
Índice de Tablas
Tabla III.1.- Estirpes mutantes utilizadas durante el desarrollo de esta Tesis ............. 42
Tabla III.2.- Oligonucleótidos empleados durante el desarrollo de esta Tesis............. 45
Tabla III.3.- Antibióticos utilizados durante el desarrollo de esta Tesis........................ 47
Tabla III.4.- Genotipado molecular de los alelos icu4 .................................................. 67
Tabla III.5.- Valores del estadístico χ2 con distintos grados de libertad (GL)............... 68
Tabla IV.1.- Tiempo de floración y número de hojas que forman la
roseta en el silvestre (En-2) y en las plantas mutantes icu4-1 ................ 75
Tabla IV.2.- Análisis histológico del tallo del silvestre En-2 y del mutante icu4-1 ........ 76
I.- Introducción
Introducción 2
I.- Introducción
I.1.- El desarrollo vegetal
Se denomina desarrollo al conjunto de cambios progresivos que experimenta
el cigoto hasta que se convierte en un organismo pluricelular adulto. Los principales
procesos implicados en el desarrollo son la división, la diferenciación, la migración y la
muerte celular, los cuales derivan en la formación de patrones y la morfogénesis.
Estos fenómenos, que finalmente desembocan en la construcción del plan general
corporal del organismo, están controlados genéticamente (Wolpert et al., 2002; Gilbert,
2003).
A lo largo de los siglos, filósofos y científicos se han preguntado acerca del
comportamiento coordinado de las células, que permite la formación de los distintos
tejidos y órganos que conforman el individuo adulto. Hasta mediados del siglo XIX, el
estudio del desarrollo se limitaba a la observación y la descripción de las estructuras, y
es a partir de entonces cuando surgió una aproximación multidisciplinar que integraba
disciplinas como la Embriología, que inicialmente se dedicaba al estudio descriptivo
del desarrollo embrionario, la Citología o estudio de la estructura y la función celular, y
más tarde, ya en el siglo XX, la Genética o estudio de la herencia biológica.
En la actualidad, la mayoría de los biólogos que realizan estudios causales
del desarrollo, tanto animal como vegetal, se dedican al análisis de la función de los
genes implicados en la ontogenia (García-Bellido, 1986; Campos-Ortega, 1994). Por lo
tanto, la inducción, el aislamiento y la caracterización de mutantes morfológicos han
constituido, durante estas últimas décadas, las principales herramientas de trabajo de
la Biología del desarrollo, ya que posibilitan la identificación de los genes afectados,
responsables últimos de la elaboración de los distintos programas del desarrollo
(Jürgens et al., 1991; Wolpert et al., 2002).
Históricamente, el análisis del desarrollo vegetal ha recibido menos atención
que el del desarrollo animal. Así, algunos conceptos clave de la Biología del desarrollo
como los de determinación, diferenciación, totipotencia celular o formación de patrones
tienen su origen en el estudio de la ontogenia animal. No obstante, también debemos
algunos principios fundamentales a los estudios sobre el desarrollo de las plantas.
Entre éstos, podemos citar los conceptos de homología, morfología y equivalencia
(Goethe, 1790), la identificación del núcleo y el protoplasma (Brown, 1835), la teoría
celular (Schleiden, 1839) o la alternancia de generaciones o ciclo digenético
(Hofmeister, 1851).
Introducción 3
El estudio del desarrollo vegetal es importante no sólo por la relevancia
económica y social de las especies cultivadas, sino también por su contribución al
conocimiento de los mecanismos de desarrollo que son específicos de las plantas
(Meyerowitz y Pruitt, 1985). Cabe recordar que el desarrollo multicelular de plantas y
animales ha evolucionado de forma paralela, ya que el último ancestro común de
ambos reinos fue un eucariota unicelular. Por tanto, a pesar de haber evolucionado a
partir del mismo conjunto inicial de genes, difieren en sus mecanismos de desarrollo.
Es por ello que los estudios comparativos de estos mecanismos en plantas y animales
pueden permitirnos determinar si los procesos de diferenciación y formación de patrón
en los distintos reinos son similares y representan las únicas vías posibles o si,
alternativamente, se han elegido entre una variedad de posibles soluciones,
permaneciendo los procesos actuales como resultado del azar evolutivo y la historia
filogenética (Meyerowitz, 1994).
Algunas de las diferencias entre el desarrollo animal y el vegetal se deben a
la presencia de la pared rígida dispuesta alrededor de las células vegetales, que
impide las migraciones y los movimientos celulares característicos de la embriogénesis
animal. En ausencia de migración celular, la morfogénesis vegetal se basa
fundamentalmente en el control de la expansión y la división celular, que posibilita el
crecimiento diferencial de las estructuras, y en la diferenciación dependiente de la
posición. En relación con este último concepto, el aislamiento celular debido a la
presencia de la pared no es total, ya que la existencia de receptores extracelulares y
de puentes citoplasmáticos denominados plasmodesmos (Cilia y Jackson, 2004)
permite que haya comunicación entre células y procesos de información posicional.
Las plantas presentan una estructura corporal simple, con no más de 40 tipos
celulares distintos. Este hecho contrasta, en gran medida, con la compleja
organización corporal de los animales, en los que podemos distinguir alrededor de 100
tipos celulares distintos (Lyndon, 1990; Howell, 1998). El desarrollo vegetal es, a
diferencia del animal, un proceso fundamentalmente postembrionario (Lyndon, 1990;
Howell, 1998; Bäurle y Laux, 2003). Así, la embriogénesis sólo genera un rudimento
del adulto, de forma que la organogénesis tiene lugar en etapas posteriores a partir de
los meristemos. Éstos son estructuras formadas por células sin pared celular
diferenciada, capaces de dividirse, expandirse y diferenciarse para dar lugar de
manera continua y reiterada a todos los tejidos de la planta, tanto somáticos como
reproductivos. A partir del meristemo caulinar o apical se formarán las estructuras
correspondientes a las partes aéreas del individuo, siendo el meristemo radicular el
responsable de la formación de la raíz.
Introducción 4
La totipotencia que caracteriza a las células de los meristemos puede
presentarse en otros linajes celulares. Este hecho supone un ejemplo de la enorme
plasticidad que presenta el desarrollo vegetal, que permite a las plantas, organismos
sésiles, enfrentarse con éxito a las variaciones de su entorno, e indica que la identidad
celular, una vez establecida, debe ser mantenida activamente para evitar el retorno al
estado indiferenciado de las células meristemáticas (Taylor, 1997; Laux, 2003).
I.2.- Utilización de los sistemas modelo en el estudio del desarrollo.
Las ventajas del estudio del desarrollo en los sistemas modelo, especies en
cuyo análisis experimental se concentran los esfuerzos de un amplio grupo de equipos
de investigación, están supeditadas a la posibilidad de extrapolar los conocimientos
derivados de su estudio a otros organismos (Bolker, 1995). Puesto que van a utilizarse
de forma habitual y sistemática para la experimentación, los organismos modelo deben
presentar características que faciliten su mantenimiento y manipulación en el
laboratorio, y que, además, permitan la obtención de resultados en un periodo de
tiempo razonablemente breve. Lo que caracteriza a estos organismos es un ciclo de
vida corto, un tamaño pequeño, su facilidad de propagación y un mantenimiento
barato. Además, resulta de mucha utilidad que tanto su morfología como su genoma
sean relativamente simples. De esta forma, se facilita la interpretación de los
resultados obtenidos durante su estudio.
Entre los sistemas modelo utilizados en el estudio de la Biología del desarrollo
animal podemos destacar el díptero Drosophila melanogaster, el nematodo
Caenorhabditis elegans, el pez cebra (Danio rerio), el anfibio Xenopus laevis, el pollo
(Gallus gallus) o el ratón (Mus musculus). Para la elección de especies vegetales, el
criterio que se ha seguido durante la mayor parte del siglo XX ha sido el del interés por
las plantas empleadas en la agricultura. Es por ello que, inicialmente, la especie mejor
estudiada en cuanto a su genética, biología molecular y desarrollo fuera el maíz (Zea
mays), una planta de más de dos metros de altura y con una sola generación anual
(Fosket, 1994). Algo similar ocurría con otras especies, como el tomate (Lycopersicon
esculentum), el guisante (Pisum sativum) o el tabaco (Nicotiana tabacum). La especie
más estudiada en la actualidad es Arabidopsis thaliana, seguida por la escrofulariácea
Antirrhinum majus. Si bien, en los últimos años, empiezan a utilizarse nuevas especies
vegetales, casos de la monocotiledónea Oryza sativa, la leguminosa Medicago
truncatula o el briófito Physcomitrella patens.
Introducción 5
I.3.- Arabidopsis thaliana como sistema modelo en el estudio del desarrollo
vegetal.
A partir de mediados de la década de los ochenta, numerosos laboratorios
han escogido Arabidopsis thaliana, una crucífera sin valor económico, como sistema
modelo para el estudio de los procesos biológicos de las plantas; y en la actualidad,
esta especie se ha convertido en la planta modelo por excelencia (Bowman, 1994;
Meyerowitz, 2001; Page y Grossniklaus, 2002). Nada hace pensar que Arabidopsis
difiera del resto de las plantas con flores en los aspectos básicos de su biología, por lo
que se espera que las conclusiones derivadas de su estudio se puedan aplicar al
análisis de numerosos aspectos estructurales y funcionales de otras especies
vegetales (Meyerowitz y Somerville, 1994).
Arabidopsis thaliana (L.) Heynh. (Fig. I.1)
es
una
planta
vascular,
una
angiosperma
Dicotiledónea que pertenece a la amplia familia de
las
Brasicáceas
o
Crucíferas,
formada
por
aproximadamente 340 géneros y más de 3.300
especies (Al-Shehbaz, 1984; Strasburger, 1994). A
esta familia pertenecen plantas herbáceas, como
Capsella bursa-pastoris o diversos Lepidium, o
arbustivas, caso del Boleum asperum, así como
plantas de interés en la agricultura, como diversas
variedades de la col (Brassica oleracea), el rábano
(Raphanus sativus), el nabo (B. napus subsp.
rapifera), plantas oleaginosas como la colza (B.
napus var. arvensis), especias como las mostazas
blanca
y
negra
(Sinapis
alba
y
B.
nigra,
respectivamente) o plantas ornamentales como los
alhelíes
Erysimum
cheiri
y
Mathiola
incana
Figura I.1.- Arabidopsis thaliana.
(Strasburger, 1994).
Al igual que sucede en la mayoría de las crucíferas, Arabidopsis es una
especie cosmopolita (Strasburger, 1994), por lo que resulta difícil conocer su origen
geográfico exacto. No obstante, se ha sugerido que es originaria de Asia Central
(Rédei, 1970), habiéndose dispersado durante los últimos 100.000 años por las
regiones de clima moderado (Meyerowitz, 1987; Innan et al., 1997). Arabidopsis fue
descubierta y descrita en el siglo XVI por Johannes Thal (de ahí su epíteto específico,
thaliana), quien la denominó inicialmente Pilosella siliquosa. A comienzos del siglo XX,
Introducción 6
Friedrich Laibach llevó a cabo los primeros estudios con esta crucífera (Laibach, 1907;
Rédei, 1970; Bowman, 1994). Sin embargo, no fue hasta la década de los cuarenta
cuando el propio Laibach reconoció las bondades de Arabidopsis para su utilización en
el trabajo experimental de laboratorio (Laibach, 1943). Así, en 1947, junto a su
colaboradora Erna Reinholz, obtuvo la primera colección de mutantes inducidos por
rayos-X (citado en Meyerowitz, 2001; Page y Grossniklaus, 2002; Somerville y
Koornneef, 2002).
Dos décadas después, tras el descubrimiento de los mutágenos químicos,
varios grupos de investigación alabaron las propiedades de Arabidopsis para su
utilización en estudios de mutagénesis. En 1964, diversos investigadores que
trabajaban con esta crucífera crearon el denominado Arabidopsis Information Service
(AIS), que tenía como propósito el intercambio de información entre los distintos
grupos. Poco tiempo después, en 1965, se celebró el primer simposio sobre
Arabidopsis
(http://www.arabidopsis.org/ais/1965/contents01S.html),
con
lo
que
comenzó a organizarse la comunidad de científicos que utilizaban esta planta como
modelo experimental. Sin embargo, en la década de los setenta, disminuyó el interés
por esta crucífera, probablemente por la utilización de otras especies vegetales que
ofrecían mayores ventajas como modelos en los estudios fisiológicos.
La década de los ochenta puede ser considerada como el resurgir de esta
especie en lo que respecta a su uso como organismo modelo para los estudios
genéticos, fisiológicos, bioquímicos y moleculares en las plantas, siendo considerada
en la actualidad como la Drosophila de la Biología vegetal (Meyerowitz y Pruitt, 1985;
Meyerowitz, 1989). Durante estos años, el notable incremento en la cantidad de
herramientas disponibles para el trabajo experimental con esta crucífera se ha
traducido en un gran aumento en el número de publicaciones sobre Arabidopsis.
I.4.- Singularidades de Arabidopsis thaliana.
Entre las características que han llevado a que Arabidopsis sea utilizada como
organismo modelo en Biología vegetal, destacan su capacidad de crecimiento bajo
condiciones controladas, así como su pequeño tamaño, que permite cultivar hasta
10.000 plantas/m2. Presenta, además, un ciclo de vida corto, que se completa en unas
6 semanas, lo que favorece la obtención de hasta 8 generaciones al año en
condiciones de cultivo optimizadas para un crecimiento rápido, con temperatura de
25ºC e iluminación continua. Dado que es una especie autógama, se autofecunda sin
necesidad de la intervención humana, bastando un solo cruzamiento manipulado para
Introducción 7
la obtención de poblaciones F2. Se trata de una especie muy prolífica y su numerosa
descendencia, que puede alcanzar las 10.000 semillas por planta, facilita el análisis
genético. Las semillas pueden almacenarse varios años a temperatura ambiente, sin
pérdida de su viabilidad.
Por otro lado, Arabidopsis posee el genoma más pequeño conocido hasta el
momento dentro de las plantas superiores, con tan sólo 125 Mb (The Arabidopsis
Genome Initiative, 2000), de las que únicamente un 10% constituyen DNA repetido.
Estructurado en cinco cromosomas, el pequeño tamaño de su genoma facilita, en gran
medida, los estudios moleculares, así como la clonación basada en la cartografía
génetica (Leutwiler et al., 1984; Pruitt y Meyerowitz, 1986; Meinke et al., 1998;
Meyerowitz, 2001; Page y Grossniklaus, 2002).
A pesar de las pequeñas dimensiones de su genoma, Arabidopsis presenta las
características típicas de otras angiospermas en lo referente a morfología, anatomía,
crecimiento, desarrollo y respuestas al ambiente. Tras la consecución de la secuencia
íntegra del genoma de Arabidopsis, se ha podido determinar que contiene un total de
25.498 presuntos genes. Sorprendentemente, este número se acerca al que se ha
estimado para la especie humana, cerca de 30.000 genes (International Human
Genome Sequencing Consortium, 2001), y es muy superior a los 13.601 predichos
para Drosophila melanogaster (Adams et al, 2000) o los 19.099 para Caenorhabditis
elegans (The Caenorhabditis elegans Sequencing Consortium, 1998).
La facilidad con la que se puede mutagenizar esta planta, ya sea con
mutágenos físicos, como los neutrones rápidos o los rayos X, químicos, caso del
metanosulfonato de etilo (EMS), o bien mediante transposones o el T-DNA de
Agrobacterium tumefaciens, permite la obtención de mutantes con fenotipos de interés
que son susceptibles de ser utilizados en el análisis genético para el abordaje de
problemas biológicos concretos.
No obstante, aproximadamente el 65% de los genes de Arabidopsis son
miembros de alguna familia génica (The Arabidopsis Genome Initiative, 2000), lo que
complica los estudios genéticos. Una estrategia para solventar los problemas
asociados a la redundancia génica es el aislamiento de alelos de ganancia de función
o de alelos dominantes negativos (Estelle y Somerville, 1986; Bleecker et al., 1988;
Wilson et al., 1996; McConnell y Barton, 1998; Weigel et al., 2000; McConnell et al.,
2001; Dievart et al., 2003; Shpak et al., 2003; Prigge et al., 2005). Así mismo, la
genética inversa ha resultado muy productiva en el estudio de familias génicas con
redundancia funcional (Hua y Meyerowitz, 1998; Siegfried et al., 1999; Pelaz et al.,
Introducción 8
2000; Alonso et al., 2003; Franklin et al., 2003; Friml et al., 2003; Pinyopich et al.,
2003). Estos trabajos se han centrado en pequeñas familias génicas o en grupos de
genes relacionados pertenecientes a grandes familias.
Con el empuje de las nuevas tecnologías, ha incrementado enormemente el
número disponible de herramientas bioinformáticas para el análisis de Arabidopsis.
Así, en la dirección de Internet correspondiente al TAIR (The Arabidopsis Information
Resource),
http://www.arabidopsis.org,
podemos
encontrar
periódicamente
actualizaciones de la información acerca de genes, mutantes, polimorfismos, medios
de cultivo y demás herramientas de utilidad en el estudio de la biología de esta
crucífera (García-Hernández et al., 2002).
I.5.- Estructura corporal de Arabidopsis thaliana.
El desarrollo vegetativo de Arabidopsis comienza con la germinación, tras la
rotura de la cubierta de la semilla y la emergencia de la radícula. A continuación, se
produce la elongación del hipocotilo y el desarrollo de las hojas vegetativas. Al final del
desarrollo vegetativo, tras la integración de distintas señales tanto exógenas (luz,
fotoperiodo, nutrientes, temperatura) como endógenas (hormonas, regulación génica),
tiene lugar la transición floral, con lo que la planta pasa de una fase vegetativa a una
reproductiva (Martínez-Zapater y Somerville, 1990; Blázquez et al., 2001; Mouradov et
al., 2002; Simpson y Dean, 2002).
El meristemo radicular da origen a toda la raíz, mientras que las partes aéreas
de la planta se generan a partir del meristemo apical, mediante la producción reiterada
de unidades denominadas fitómeros (Galinat, 1959) o metámeros (White, 1984). Se
han descrito tres tipos de fitómeros en Arabidopsis (Schultz y Haughn, 1991), cada
uno de los cuales se origina en una etapa distinta del ciclo de vida (Fig. I.2).
Básicamente, los tres se disponen según un patrón de filotaxia espiral, con un ángulo
de divergencia entre órganos sucesivos de aproximadamente 137,5°. Los fitómeros de
tipo 1 se forman durante la fase de desarrollo vegetativo, y se caracterizan por la
elongación casi nula de los entrenudos, con lo que se forma una roseta basal. Cada
nudo está constituido por una hoja vegetativa y un meristemo axilar del que puede
surgir una rama o inflorescencia secundaria (paraclado). Pueden distinguirse dos
fases: una roseta temprana, formada por dos pares de hojas juveniles redondeadas,
pequeñas y enteras, que carecen de tricomas en su superficie ventral o envés y se
disponen según un patrón de filotaxia decusada, es decir, cada par de hojas muestra
Introducción 9
un ángulo de divergencia de 180°; y
Tallo principal
una roseta adulta, formada por hojas
aserradas de mayor tamaño, con
tricomas en sus dos superficies y
dispuestas
filotaxia
según
espiral
un
patrón
de
(Martínez-Zapater,
1994; Haughn et al., 1995). Una vez
aparecen las hojas de la roseta
adulta, el resto de hojas y flores se
generarán en el tallo siguiendo un
patrón de filotaxia espiral. También
Hojas caulinares
para el tallo principal o inflorescencia
primaria se consideran dos fases,
una de ellas temprana, formada por
Hojas de la
roseta
fitómeros de tipo 2 que presentan
largos entrenudos y hojas caulinares
Figura I.2.- Representación esquemática del plan
con ramas laterales (inflorescencias
corporal de Arabidopsis thaliana. Se muestra los tres
secundarias o paraclados) en sus
tipos de fitómeros (1, 2 y 3). O, flores; 2p y 3p
axilas. En este tipo de fitómero
paraclados
orden,
puede aparecer una segunda rama
respectivamente; *, axila sin paraclado en una rama
(rama accesoria) entre la axilar y la
de
segundo
y
tercer
accesoria. Tomado con modificaciones de Talbert et
al., 1995.
hoja caulinar (Fig. I.2).
En etapas más tardías, el
tallo principal está formado por fitómeros de tipo 3. Éstos constituyen la porción
terminal fértil que confiere al tallo la denominación de inflorescencia (Weberling, 1989).
Los fitómeros de tipo 3 presentan entrenudos no muy largos y nudos con flores no
acompañadas de hojas.
Según Goethe (1790), las flores son tallos especializados que presentan
órganos florales en lugar de hojas. Por lo tanto, las flores de Arabidopsis pueden
considerarse como ramas florales homólogas a las ramas axilares; aunque, mientras
que las flores presentan un crecimiento determinado y están formadas por tipos
especiales de fitómeros (cuatro verticilos de órganos concéntricos), el crecimiento
indeterminado de las ramas axilares y accesorias repite, en parte, el patrón de
fitómeros del tallo principal (Weberling, 1989), pudiéndose observar paraclados de
segundo y, eventualmente, de tercer orden (Fig. I.2).
Introducción 10
I.6.- Desarrollo de Arabidopsis thaliana.
I.6.1.- Desarrollo embrionario.
El plan básico de la organización corporal del organismo adulto se genera
durante la embriogénesis (Jürgens et al., 1991; Mayer et al., 1991). Esto implica la
formación de los meristemos radicular y caulinar o apical, los cotiledones, la radícula y
el hipocotilo, y resulta en el establecimiento del eje apical-basal de la planta y la
formación de un patrón radial que se manifiesta en la ordenación concéntrica de la
epidermis y la vasculatura. Estos elementos de patrón se establecen muy
tempranamente durante la embriogénesis y se mantienen a lo largo del ciclo de vida
de la planta (Laux y Jürgens, 1997).
El desarrollo embrionario de Arabidopsis es muy similar al de Capsella bursapastoris, otro miembro de la familia de las Brasicáceas, utilizada habitualmente como
modelo de la embriogénesis de las plantas dicotiledóneas (Esau, 1977). Los estadios
de la embriogénesis se han definido de acuerdo al número de células derivadas de la
célula apical o a la forma de los embriones en desarrollo: cigoto, dos células
terminales, cuadrante, octante, dermatógeno, globular, triangular, corazón, torpedo y
cotiledonar (Fig. I.3).
E
D
A
B
cot
C
mc
cot
mc
pd
hc
ca
cb
rd
su
mr
Figura I.3.- Establecimiento del plan corporal de Arabidopsis thaliana. (A) Estadio de dos células
terminales. Mediante una división asimétrica del cigoto se forma una célula apical (ca) y una basal de
mayor tamaño (cb). (B) Estadio de octante. A partir de la célula basal se ha generado el suspensor (su).
(C) Estadio de dermatógeno. Divisiones tangenciales separan el protodermo (pd) de las células internas.
(D) Estadio de corazón. El dominio apical del embrión se divide en cotiledones (cot) y meristemo caulinar
o apical (mc). (E) Plántula. A lo largo del eje apical-basal se sitúan los cotiledones, el meristemo apical, el
hipocotilo (hc), la radícula (rd) y el meristemo radicular (mr). Tomado con modificaciones de Laux y
Jürgens, 1997.
Introducción 11
La primera división del cigoto en Arabidopsis es transversal y asimétrica, y
produce una pequeña célula apical o terminal (chalazal), que dará lugar a la mayor
parte del embrión, y a una célula basal alargada (micropilar), de la que derivarán la
radícula y el suspensor, un tejido extraembrionario a través del cual el embrión obtiene
nutrientes de la madre (Fig. I.3). Esta división inicial establece el eje apical-basal, que
se alinea con el eje chalaza-micrópilo, lo que sugiere una orientación influida por el
tejido materno circundante. Mediante dos divisiones longitudinales y una división
transversal, se obtiene un embrión octante de ocho células. Cada una de estas ocho
células se divide tangencialmente produciendo un embrión de 16 células, el
dermatógeno, con ocho células internas y ocho protodermales externas. Las células
protodermales del dermatógeno sufren divisiones anticlinales, mientras que las células
internas se dividen longitudinalmente. Esto da lugar al establecimiento del patrón radial
que, por lo tanto, se produce durante el estadio dermatógeno. Las células
protodermales acabarán formando la epidermis, mientras que el procámbium derivará
de las células internas, de manera que la mayoría de los elementos de patrón ya se
pueden visualizar en el estadio globular. El primordio del procámbium, consistente en
células estrechas derivadas de las células internas, se sitúa justo encima del primordio
de la raíz. A continuación, las divisiones celulares en la región de los futuros
cotiledones y la elongación celular en la región del procámbium confieren al embrión
una simetría bilateral, adoptando una forma triangular. Mediante sucesivas divisiones
celulares la región apical se engrosa lateralmente, formándose los primordios de los
cotiledones, con lo que se inicia la etapa de corazón, en la que el hipocotilo se
expande y se completa el primordio de la raíz. Como resultado de una serie de
divisiones rápidas y de elongaciones celulares, el embrión adopta la forma
característica que justifica que el siguiente estadio reciba la denominación de torpedo.
Además, el tejido provascular comienza a diferenciarse en la base de los cotiledones.
Las células centrales del hipocotilo y del primordio de la radícula se diferencian,
formando el tejido vascular primario. Por último, se produce la desecación del embrión
y su entrada en el estado de dormancia que persistirá hasta que las condiciones
ambientales sean favorables, lo que inducirá la germinación, iniciándose el periodo de
desarrollo postermbrionario (Jürgens et al., 1991).
I.6.2.- Origen y estructura de los meristemos radicular y apical.
Los meristemos radicular y apical, que se originan durante la embriogénesis
en los polos opuestos del eje apical-basal, son los responsables últimos de la
arquitectura postembrionaria de la planta. Ambos meristemos difieren tanto en el
momento en el que se originan como en su organización celular. El meristemo
Introducción 12
radicular se forma relativamente pronto durante la embriogénesis, en el estadio
corazón, y consta de tres filas de células iniciales que darán lugar a un linaje celular
bien definido (Mayer et al., 1993). El meristemo apical, por su parte, surge más tarde,
en el estadio torpedo, y muestra una organización túnica-corpus con un linaje celular
que no está definido de forma estricta (Barton y Poethig, 1993).
Las tres filas de células que forman el meristemo radicular rodean a un grupo
de células mitóticamente inactivas, el centro quiescente (Dolan et al., 1993). Por
encima del centro quiescente se van añadiendo células a las capas concéntricas de
tejido radicular, de manera que, siguiendo un patrón radial, se forman la epidermis, el
córtex, el endodermo, el periciclo y el tejido vascular (Fig. I.4). El meristemo de la raíz
comienza a ser activo en el estadio corazón, en el que la raíz embrionaria comienza a
extenderse.
A
B
Epidermis
Protofloema
Cortex
Centro quiescente
Endodermo
Caliptra lateral
Periciclo
Células iniciales
Protoxilema
Columnela
Figura I.4.- Organización radial de los tejidos en la raíz de Arabidopsis. (A) Sección longitudinal del ápice
radicular. (B) Sección transversal de la raíz aproximadamente a 1 mm del ápice. Los diferentes tipos
celulares se indican con un código de colores. Tomado con modificaciones de Dolan et al., 1993.
El meristemo apical, que se forma a partir de un grupo de células situado en
la mitad superior del embrión globular, se organiza en zonas y capas (Steeves y
Sussex, 1989; Kerstetter y Hake, 1997; Fig. I.5). Durante la transición del estadio
corazón al torpedo, se definen tres capas distintas de células que formarán la túnica
(L1 y L2) y el corpus (L3) del meristemo apical. La capa superior de la túnica (L1)
deriva del protodermo y dará lugar a la epidermis de la planta, mientras que la capa
inferior de la túnica (L2), que formará el mesófilo, y el corpus (L3), que formará el tejido
vascular, derivan de las células embrionarias internas. En el estadio embrionario de
Introducción 13
torpedo, el patrón de divisiones celulares se caracteriza por una organización túnicacorpus (Barton y Poethig, 1993).
Yuxtapuesta a esta estructura en capas, existe un segundo nivel de
organización que divide al meristemo en dos regiones diferentes, tanto anatómica
como funcionalmente, denominadas zona central (ZC) y zona periférica (ZP; Fig. I.5
A). La zona central se caracteriza por una baja tasa de división y es donde se localizan
las células totipotentes que actuarán como reserva celular de la región periférica. A
medida que las células de la zona central se incorporan a la región periférica, se inicia
su diferenciación. Estas células pasarán a formar parte de los primordios de los
órganos laterales o bien de los entrenudos, siendo reemplazadas por células de la
región central.
B
A
C
Figura I.5.- Estructura del meristemo apical de Arabidopsis. Dominios de expresión de genes implicados
en su formación y mantenimiento. (A) Representación esquemática de un corte longitudinal del meristemo
donde se observa su organización en zonas (CZ, zona central; PZ, zona periférica) y en capas (L1, L2 y
L3). (B) Representación esquemática de un corte longitudinal del meristemo, representados en color
verde los primordios de los órganos laterales y en morado el meristemo, donde se indican los dominios de
expresión de los genes CLAVATA (CLV; CLV1, indicado en rojo; CLV3, en naranja) y WÜSCHEL (WUS;
indicado en azul). (C) Vista transversal del ápice del tallo donde se muestran los dominios de expresión
de los genes KNOX, SHOOTMERISTEMLESS (STM) y KNAT1 y de los genes ASYMMETRIC LEAVES1
(AS1) y AS2. Tomado con modificaciones de Tsiantis y Hay, 2003.
I.6.2.1.- Genes implicados en la formación y el mantenimiento del meristemo
apical.
El análisis de los mutantes afectados en la formación y el mantenimiento del
meristemo apical ha permitido la identificación de genes que participan en estos
procesos (Fig. I.5 B y C). Los genes CLAVATA (CLV1, CLV2 y CLV3; Clark et al.,
1993; 1997; Kayes y Clark, 1998; Brand et al., 2000) restringen la acumulación de
Introducción 14
células totipotentes en los meristemos apical y floral. Los mutantes de pérdida de
función clv1, clv2 y clv3 presentan rasgos fenotípicos similares: meristemos de gran
tamaño, tallos fasciados y mayor número de órganos florales, típicamente carpelos
(Clark et al., 1993; 1997; Kayes y Clark, 1998; Fletcher et al., 1999).
CLV1 y CLV2 codifican receptores transmembrana con una región
extracelular rica en leucina (LRR; leucine-rich repeat; Clark et al., 1997). CLV3 codifica
un pequeño polipéptido que es secretado al espacio intercelular (Fletcher et al., 1999).
CLV3 se expresa en la zona central de las capas L1 y L2, y su producto se une al
complejo CLV1/CLV2 en L3 (Trotochaud et al., 1999; Rojo et al., 2002; Lenhard y
Laux, 2003).
La ruta de transducción de señales activada por las proteínas CLV, regula
negativamente la actividad del gen WÜSCHEL (WUS) y restringe su dominio de
expresión a un pequeño grupo de células de la capa L3 (Mayer et al., 1998; Fig. I.5 B).
WUS, que codifica un factor de transcripción con homeodominio, activa la expresión
de CLV3, y está implicado en la iniciación y localización de la población de células
meristemáticas indiferenciadas en el meristemo apical, función que ya desempeñaba
durante la embriogénesis. En los mutantes wus las células meristemáticas son
incapaces de mantener su estado indiferenciado, lo que resulta en una terminación
prematura del meristemo (Laux et al., 1996; Mayer et al., 1998). El tamaño y la
posición de la población de células totipotentes del meristemo son, por tanto,
regulados por esta vía de señalización.
Para el mantenimiento del meristemo, también se requiere la actividad del
gen KNOX (KNOTTED-like HOMEOBOX) de la clase I SHOOT MERISTEMLESS
(STM; Long et al., 1996) y de otros genes pertenecientes a dicha familia. Los mutantes
stm son incapaces de formar y mantener un meristemo apical funcional (Barton y
Poethig, 1993). La proteína STM inhibe la diferenciación de la zona central del
meristemo mediante la represión de la expresión de los genes ASYMMETRIC
LEAVES1 (AS1) y AS2 (Fig. I.5 C), que están implicados en promover la formación de
órganos laterales en la zona periférica (Byrne et al., 2000; 2002; Semiarti et al., 2001;
Iwakawa et al., 2002) y también participan en el establecimiento de la polaridad en el
eje dorsoventral o adaxial-abaxial de los órganos laterales (Xu et al., 2003).
I.6.3.- El desarrollo postembrionario.
El desarrollo vegetal es fundamentalmente postembrionario. Durante la
embriogénesis sólo se define el plan corporal básico del adulto, y es en etapas
posteriores cuando tiene lugar la organogénesis a partir de los meristemos apical y
radicular. Las plantas superiores están generalmente compuestas de dos clases
Introducción 15
distintas de órganos en base a su crecimiento y simetría. Las raíces y los tallos son
órganos indeterminados que presentan un crecimiento apical a partir de los
meristemos apical y radicular, así como un crecimiento radial a partir del cámbium
vascular, y poseen simetría radial. Los órganos laterales, como las hojas y los órganos
florales, son órganos determinados que presentan un crecimiento lateral, y polaridad y
asimetría en los ejes próximo-distal y dorsoventral o adaxial-abaxial (adaxial, próximo
al meristemo, y abaxial, alejado del meristemo). El crecimiento diferencial y asimétrico
a lo largo de estos ejes resulta en la gran variedad de formas observadas, desde los
complicados pétalos de las orquídeas hasta las hojas reducidas de las acacias.
La relación entre los órganos laterales y el meristemo apical, a partir del cual
se desarrollan, es la base para la formación de los ejes de simetría. Experimentos
quirúrgicos han sugerido que el meristemo apical produce una señal requerida para
que las células adopten el destino correcto en el eje adaxial-abaxial (Sussex, 1954), y
estudios genéticos recientes han llevado a la identificación de varios genes que se
expresan en los órganos laterales y están probablemente implicados en la
interpretación de la señal emitida por el meristemo apical (McConnell y Barton,1998;
McConnell et al., 2001; Eshed et al., 2001. Véase el apartado I.6.4).
I.6.3.1.- El desarrollo del tallo.
El tallo es la parte aérea de las cormofitas que da soporte a los órganos
laterales y las ramas. Crece buscando la luz, con geotropismo negativo, al contrario
que la raíz, y presenta simetría radial. Desde el exterior al interior, está formado por la
epidermis, la corteza, el cilindro central y la médula (Fig. I.6 A).
La epidermis proviene de la capa L1 del meristemo y está formada por una
sola fila de células rectangulares. Por debajo de la epidermis está la corteza,
constituida por un número variable de capas de parénquima. La capa más profunda de
la corteza se denomina endodermo y delimita el tránsito al cilindro central o estela.
Ésta, en Arabidopsis, es una eustela, ya que contiene haces vasculares discretos que
se disponen formando un anillo alrededor de una médula formada por células
parenquimatosas de gran tamaño con cloroplastos o amiloplastos.
La eustela está constituida fundamentalmente por el sistema vascular y por
células parenquimatosas que rellenan todos los huecos entre los distintos
componentes vasculares.
Hay diferencias notables entre los diversos grupos vegetales respecto a la
estructura primaria del tallo, principalmente en lo que concierne al desarrollo del
sistema vascular, del que depende la distribución del agua y la conexión de las hojas y
el
tallo.
El
sistema
vascular
presenta
caracteres
propios
en
pteridofitas,
Introducción 16
monocotiledóneas y dicotiledóneas, y es el exponente más significativo del grado de
complejidad estructural de un vegetal. En cualquier caso, está constituido por el
xilema, que contiene tráqueas, traqueidas, fibras del xilema y parénquima, y el floema,
que está formado por tubos y células cribosas, células anexas, células albuminíferas,
fibras liberianas y parénquima (Paniagua, 2002).
I.6.3.1.1.- Diferenciación del sistema vascular.
El sistema vascular constituye una elaborada red de tejidos conductores que
conecta todos los órganos de la planta, transportando agua, minerales, compuestos
orgánicos y moléculas de señalización. Está formado básicamente por los dos tejidos
conductores anteriormente mencionados, el xilema y el floema, y por células de los
meristemos vasculares, el cámbium y el procámbium (Paniagua, 2002).
El sistema vascular del tallo se origina a partir del procámbium. Éste se
aprecia ya en la zona más profunda del meristemo apical como cordones celulares
que se tiñen intensamente con azul de toluidina. Según la especie vegetal, el
procámbium aparece como un cilindro hueco, que es la disposición más frecuente en
las gimnospermas y las dicotiledóneas; como un cilindro sólido, en cuyo interior no hay
médula; o como un sistema de cordones paralelos al eje longitudinal del tallo, que
forman, unos respecto a otros, un cilindro discontinuo o una serie de cordones
dispersos, siendo esta disposición, la atactostela, la típica en los tallos de las
monocotiledóneas (Paniagua, 2002).
El cilindro del procámbium, o cada cordón procambial, da lugar inicialmente a
protoxilema y protofloema. En la mayoría de los tallos, el xilema se diferencia de forma
centrífuga, es decir, los elementos más maduros o metaxilema quedan en posición
más externa que los menos maduros o protoxilema. El floema, por el contrario, se
diferencia de forma centrípeta, quedando el metafloema en posición más interna que
el protofloema (Paniagua, 2002).
Existen varios tipos de haces vasculares (Ye et al., 2002; Fukuda, 2004; Fig.
I.6 B). En gimnospermas, dicotiledóneas y en algunas monocotiledóneas, el cilindro
vascular –o cada haz vascular, según la planta– es de tipo colateral, esto es, con el
floema situado en una zona más periférica que el xilema. En la mayoría de las
monocotiledóneas el patrón es anfivasal, con el xilema rodeando al floema. En las
cucurbitáceas y las solanáceas, los haces son de tipo bicolateral, es decir, con el
floema ocupando las posiciones más interna y más externa y el xilema en medio. En
los helechos, el haz vascular es anficribal, con el floema rodeando al xilema. En los
tallos de licopodiáceas la disposición es radial, observándose un xilema cruciforme en
cuyos huecos se dispone el floema.
Introducción 17
El tallo de Arabidopsis consta de 7 a 9 haces vasculares, en los que el xilema
y el floema adoptan un patrón colateral, separados por regiones interfasciculares
ocupadas por fibras lignificadas (Ye et al., 2002; Fig. I.6 A).
ep
A
B
f
pr
Colateral Bicolateral Anficribal Anfivasal
m
Figura I.6.- Organización radial de los tejidos del tallo en Arabidopsis y tipos de haces vasculares. (A)
Corte transversal de un tallo de inflorescencia de Arabidopsis donde se observa del exterior al interior, la
epidermis (ep), la corteza (co), el endodermo (e), las fibras interfasciculares (if) y los haces vasculares,
formados por floema (f), procambium (pr) y xilema (x), situados en la eustela, y la médula (m). (B)
Diferentes tipos de haces vasculares según la disposición relativa del xilema (rojo) y el floema (verde).
Tomado con modificaciones de Zhong y Ye, 2001 (A) y de Fukuda, 2004 (B).
I.6.3.1.2.- Papel de las hormonas vegetales en la formación del patrón vascular.
El desarrollo vascular comienza en el embrión con la formación de las células
provasculares que, con posterioridad, darán lugar a células del procámbium a partir de
las cuales se diferenciarán los tejidos conductores (Steeves y Sussex, 1989). En las
partes más viejas de la planta, los tejidos vasculares pueden desarrollarse a partir del
meristemo secundario denominado cámbium vascular (Esau, 1965). Las hormonas
vegetales, como las auxinas, las citoquininas y los brasinoesteroides, tienen una
función reguladora en la diferenciación de los tejidos vasculares (Ye, 2002; Fukuda,
2004).
Experimentos llevados a cabo en los años 50 demostraron que los efectos
inductivos que ejercían las hojas y los primordios de órganos en el desarrollo vascular
podían ser reemplazados por la aplicación de auxinas (Jacobs, 1952; Young, 1953).
Trabajos posteriores han demostrado el efecto de las auxinas, tanto en la inducción
como en la formación del patrón que adopta el tejido vascular (Bennet et al., 1998;
Berleth y Mattson, 2000; Ye, 2002). Sachs llevó a cabo un gran número de
experimentos en los que investigó la inducción del tejido vascular con auxinas (Sachs,
1981; 1991), a partir de los cuales propuso la hipótesis de la canalización. Según ésta,
elevados niveles de auxina incrementan la capacidad celular para su transporte polar,
lo que genera un mecanismo de retroalimentación positiva que permite la canalización
del flujo de la hormona. La diferenciación vascular tiene lugar, dentro de las regiones
Introducción 18
por las que fluye la auxina, en los sitios de máxima concentración de ésta. La
identificación de la proteína PINFORMED1 (PIN1) fue un apoyo para la hipótesis de la
canalización. PIN1 es esencial para el transporte polar de auxina y, normalmente, se
localiza en la membrana basal de la célula (Galweiler et al., 1998). Durante el
desarrollo embrionario, se produce la transición de una localización de PIN1 uniforme,
por toda la membrana celular, a una orientada a lo largo del eje apical-basal, lo que es
consistente con un mecanismo de retroalimentación positiva por auxina (Steinmann et
al., 1999). Además, la localización anormal de PIN1 en los mutantes emb30/gnom
resulta en una proliferación de tejido vascular acorde con el reparto de auxinas a tipos
celulares inapropiados (Steinmann et al., 1999; Koizumi et al., 2000).
Sachs también sugirió la existencia de una función implicada en la inhibición
del desarrollo de los haces vasculares. Éstos, formados en los sitios con elevadas
tasas de transporte de auxina, son capaces de inhibir el desarrollo de nuevos haces en
sus proximidades (Sachs, 1981; 1991). Aunque las auxinas son capaces de inducir la
formación de primordios, una vez formados, la región adyacente a esos primordios se
vuelve insensible a posteriores aplicaciones de la hormona. El mecanismo por el cual
las auxinas, u otras moléculas producidas por los primordios en desarrollo, ejercen su
acción inhibidora no se conoce (Reinhardt et al., 2000).
El aislamiento de mutantes que presentan islas de tejido vascular no
conectadas a tejido vascular preexistente son difíciles de explicar mediante la hipótesis
de la canalización (Carland et al., 1999; Deyholos et al., 2000; Koizumi et al., 2000).
Algunos de estos mutantes responden de forma normal a tratamientos con auxina y se
explican más fácilmente mediante la hipótesis de la difusión-reacción. Esta hipótesis
se basa en un modelo computacional y propone que la interacción de dos sustancias
que difunden, con tasas de difusión diferentes, regula la formación autónoma de venas
en un tejido inicialmente uniforme. Una de esas sustancias promueve la inducción del
tejido vascular, mientras que la otra resulta en la inhibición del desarrollo vascular
(Koch y Meinhardt, 1994). Aunque se conocen sustancias con efectos inductores,
como las auxinas, aún no se ha descrito compuesto alguno capaz de inhibir el
desarrollo vascular.
Los mecanismos moleculares que controlan la formación del patrón vascular
todavía no se conocen. Se ha aislado un número limitado de mutantes que muestran
un patrón vascular alterado en el tallo. El mutante amphivasal vascular bundle (avb1;
Zhong et al.,1999) presenta un incremento en el número de haces vasculares en el
tallo, algunos de los cuales pierden su localización normal en la eustela y se sitúan, de
manera anormal, en la médula. Sus haces vasculares muestran, además, un patrón
anfivasal. Otro mutante, acaulis5 (acl5; Hanzawa et al., 1997), presenta una cubierta
Introducción 19
de células con paredes engrosadas que rodea a los haces vasculares. Aunque el
número de haces vasculares en las plantas acl5 es similar al silvestre, la cantidad de
tejido vascular diferenciado es mayor en el mutante. CONTINUOUS VASCULAR
RING1 (COV1; Parker et al., 2003) está implicado en el mantenimiento del patrón
vascular ordenado del tallo. Mutaciones en este gen alteran el patrón vascular,
resultando en un anillo continuo de xilema y floema, con muy poco tejido
interfascicular. COV1 es una proteína de membrana que podría participar en una vía
de señalización que regulara negativamente la diferenciación del tejido vascular.
I.6.3.2.- El desarrollo de la hoja.
Las hojas son órganos laterales con una función primordial en la fotosíntesis.
Se originan en los flancos del meristemo apical, donde las células fundadoras se
dividen rápidamente para formar pequeñas excrecencias, denominadas hojas P1, que
adquirirán una apariencia plana conforme se van desarrollando. En Arabidopsis , el
mecanismo que permite distinguir las células fundadoras del órgano de las de división
lenta presentes en el meristemo implica la ausencia de transcripción de los genes
KNOX de clase I STM (véase apartado I.6.2.1), BREVIPEDICELLUS (BP, también
conocido como KNAT1), KNAT2 y KNAT6 en la posición donde se iniciará la hoja. De
hecho, STM nunca se expresa en los primordios foliares, lo que permite la
transcripción de los genes AS1 y AS2 (véase apartado I.6.2.1) en las hojas P1 (Byrne
et al., 2000; 2002). Ambos genes interaccionan en la misma vía para promover la
diferenciación de las células de los primordios foliares mediante la represión de BP,
KNAT2 y KNAT6 (Semiarti et al., 2001; Byrne et al., 2002).
A medida que se desarrolla, la hoja se aparta del ápice y toma forma de
lámina ovalada. En cada hoja, se distingue un pecíolo, que conecta con el tallo, y el
limbo o lámina foliar, que es el órgano fotosintético por excelencia (Fig. I.7 A). El limbo
es quizá el órgano más polimorfo de los vegetales. Generalmente, es una lámina
aplanada que muestra polaridad a lo largo del eje dorsoventral (adaxial-abaxial). No
obstante, también puede adquirir una forma cilíndrica, como en las coníferas, un
aspecto tubular, como en algunas plantas insectívoras, o estar aplanadas
lateralmente, como es el caso de Iris.
Los primordios foliares se forman mediante la proliferación de grupos de
células situados en la capa superficial del meristemo apical (coníferas y algunas
monocotiledóneas) o en la segunda o tercera capa de células del meristemo
(dicotiledóneas y algunas monocotiledóneas). La asimetría en la lámina foliar a lo largo
del eje adaxial-abaxial se manifiesta en la existencia de dos caras con características
distintas, una adaxial o dorsal, el haz, y otra ventral o abaxial, el envés (Fig. I.7 B).
Introducción 20
La epidermis aísla a la hoja de su entorno y regula el intercambio de gases
con el exterior. Contiene abundantes estomas y tricomas, siendo éstos más
abundantes en la superficie adaxial. El mesófilo está fundamentalmente formado por
parénquima, con dos estratos diferentes: el parénquima en empalizada y el
parénquima lagunar. El parénquima en empalizada se sitúa inmediatamente por
debajo de la epidermis adaxial, estando constituido por células prismáticas y alargadas
en la orientación dorsoventral, que dejan pocos espacios intercelulares. Estas células
contienen abundantes cloroplastos que se disponen en la periferia celular. El
parénquima lagunar está formado por células que contienen menos cloroplastos que el
parénquima en empalizada y son de forma irregular y variable, aunque siempre
presentan lóbulos que les permiten unirse entre sí dejando grandes espacios llenos de
aire (Fig. I.7 B). Se puede decir que si el parénquima en empalizada está
especializado en la fotosíntesis, el parénquima lagunar lo está en el intercambio de
gases que, a través de las cámaras subestomáticas y los estomas, alcanzan el
exterior. Con ello, aumenta la eficacia de la fotosíntesis.
B
A
distal
ad
pe
pl
xi
fl
proximal
ab
Figura I.7.- Morfología de la hoja. (A) Hoja de Antirrhinum que presenta un pecíolo proximal y un limbo
distal. (B) Corte transversal de una hoja de Arabidopsis donde se observa la asimetría en el eje adaxialabaxial: epidermis adaxial (ad), parénquima en empalizada (pe), parénquima lagunar (pl), epidermis
abaxial (ab), xilema en posición adaxial (xi) y floema en posición abaxial (fl). Modificado de Golz y Hudson,
2002 (A) y Bowman et al., 2002 (B).
En la hoja entran varios haces vasculares que pueden continuar paralelos a lo
largo de todo el órgano, situación común en las monocotiledóneas, o ramificarse,
como sucede en muchas dicotiledóneas. El conjunto de esta estructura vascular se
denomina venación. Las venas pequeñas incluyen un haz vascular con sus tejidos
protectores, mientras que las grandes venas están formadas por un grupo de haces
vasculares.
En Arabidopsis, el patrón de venación es broquidódromo (Candela et al.,
1999). La vena mayor es la que penetra por la base de la hoja, dando lugar a la gran
Introducción 21
vena central o principal. De ella se van separando grandes ramas hacia los lados, que
se anastomosan entre sí, formando una serie de arcos que no llegan a alcanzar el
margen foliar. Además, se observa toda una serie de venas secundarias y terciarias
que unen la principal y las grandes venas, produciendo territorios intervasculares de la
hoja o areolas. Las ramificaciones venosas de menor tamaño terminan en extremos
ciegos muy finos.
I.6.3.3.- El desarrollo de los órganos florales.
En las angiospermas, los órganos implicados en las funciones reproductoras
se localizan en estructuras especializadas llamadas flores. La flor se puede considerar
como un eje caulinar, denominado pedúnculo, más o menos reducido y de crecimiento
definido, que se ensancha en el extremo apical, formando el tálamo o receptáculo.
Éste da asiento a los verticilos, que contienen filomas transformados en órganos
florales. Los órganos sexuales forman el androceo y el gineceo, mientras que otra
serie de filomas, que constituyen el cáliz y la corola, tienen una función colateral, de
tipo auxiliar del proceso reproductivo. La flor se origina en el período reproductivo a
partir del meristemo apical del tallo principal o de las ramas laterales.
En una flor, desde el verticilo más externo al más interno, encontramos los
órganos siguientes: los sépalos y los pétalos, que forman el perianto que rodea a los
órganos reproductores; los estambres, que son un grupo de filamentos rematados en
una parte dilatada apical llamada antera, donde se forman los gametófitos masculinos,
y los carpelos, que constan de una parte basal dilatada llamada ovario, donde se
forman los gametófitos femeninos, se prolongan en un cuello alargado, el estilo, y
terminan en una posición apical denominada estigma (Fig I.8).
La flor de Arabidopsis ha sido descrita con gran detalle, tanto en cuanto a su
morfología como a su ontogenia (Smyth et al., 1990). Presenta la estructura típica de
las flores de las Brasicáceas, con simetría radial. Se compone de cuatro verticilos
concéntricos, que comprenden cuatro sépalos, cuatro pétalos situados en posiciones
alternas a las de los sépalos, seis estambres y dos carpelos que se fusionan formando
un pistilo (Fig. I.8).
El orden de aparición de los verticilos suele darse de acuerdo con su posición
en el tálamo. El ritmo de crecimiento de cada verticilo suele ser diferente al de los
demás y no guarda relación con la cronología de su aparición. Así, en Arabidopsis, los
pétalos surgen antes que los estambres, aunque luego se desarrollan con más
lentitud. Los carpelos tienen un crecimiento inicial más rápido que el de los estambres,
pero el de éstos continúa mientras se detiene el de aquéllos, con lo que los estambres
Introducción 22
rebasan finalmente a los carpelos, quedando la antera en una posición idónea para la
polinización del estigma.
A
estambres
carpelos
B
pétalo
sépalo
pétalos
sépalos
estambre
pedicelo
pistilo
Figura I.8.- Morfología de la flor de Arabidopsis. (A) Fotografía de una flor de Arabidopsis donde se
indican sus órganos. (B) Diagrama floral de Arabidopsis donde se representan sus cuatro verticilos
concéntricos, que comprenden cuatro sépalos, cuatro pétalos, seis estambres y dos carpelos que se
fusionan formando un pistilo. Tomado con modificaciones de http://www.salk.edu/LABS/pbio-w/gallery.html
(A) y www.botany.ubc.ca/ haughn/overview.htm (B).
Las flores se forman a partir de meristemos florales que derivan de los
meristemos de inflorescencia. Ambos meristemos son muy similares en estructura,
pero mientras que los meristemos de inflorescencia son indeterminados, los
meristemos florales son determinados y tras producir un número finito de órganos se
detiene su crecimiento. Esto implica el cese de la actividad de las células
meristemáticas indiferenciadas y su incorporación a los primordios de los órganos
florales (Okamuro et al., 1996; Poutau et al., 1997; Washburn y Thomas, 2000; Zik e
Irish, 2003).
Genes importantes en Arabidopsis para la identidad del meristemo floral son
AGAMOUS (AG; Bowman et al., 1989; Yanofsky et al., 1990), LEAFY (LFY; Schultz y
Haughn, 1991; Huala y Sussex, 1992; Weigel et al., 1992), APETALA1 (AP1; Irish y
Sussex, 1990; Mandel et al., 1992; Bowman et al., 1993), AP2 (Kunst et al., 1989;
Riechmann y Meyerowitz, 1998) y CAULIFLOWER (CAL; Bowman et al., 1993).
Algunos de ellos participan también en la determinación de los órganos florales (Fig.
I.9; ver más adelante). La expresión de AG, un factor de transcripción de tipo MADS,
se inicia en etapas muy tempranas del desarrollo floral, restringiéndose al ápice del
meristemo, en las células que formarán los estambres y los carpelos. La actividad de
AG parece ser suficiente para conferirle al meristemo floral su naturaleza determinada
(Mizukami y Ma, 1997). El gen LFY comienza a expresarse durante la etapa de
transición floral. Se expresa específicamente en el meristemo floral e induce la
Introducción 23
expresión de genes implicados en la formación de los órganos florales (Weigel et al.,
1992; Blázquez y Weigel, 2000; Lohmann et al., 2001). Con posterioridad a la
expresión inicial de LFY, lo hacen AP1 y CAL. Estos dos últimos genes son parálogos
muy cercanos que codifican factores de transcripción de tipo MADS (Mandel et al.,
1992; Bowman et al., 1993). AP2 está implicado tanto en la regulación de la identidad
del meristemo floral como en el desarrollo de la semilla (Jofuku et al., 1994). Codifica
una proteína de unión a DNA de tipo EREBP (Ethylene Responsive Element Binding
Protein; Riechmann y Meyerowitz, 1998). También participan en el proceso otros
genes, como por ejemplo, el gen FRUITFULL (FUL; Gu et al., 1998; Ferrándiz et al.,
2000), otro parálogo cercano a AP1 y CAL.
Los genes anteriores, junto a otros como WUS (véase apartado I.6.2.1) y
UNUSUAL FLORAL ORGANS (UFO; Ingram et al., 1995; Levin y Meyerowitz, 1995),
están implicados en la activación transcripcional de los genes homeóticos encargados
de conferir identidad a los órganos florales, según el modelo ABC (Bowman et al.,
1991; Coen y Meyerowitz, 1991; Meyerowitz et al., 1991; Coen, 1992; Weigel y
Meyerowitz, 1994; Lohmann y Weigel, 2002), que ha sido recientemente redefinido
con la introducción de los genes de la clase E, SEPALLATA1, 2 , 3 y 4 (SEP1, 2, 3 y 4;
Pelaz et al., 2000; 2001; Ditta et al., 2004; Fig. I.9).
Figura I.9.- Revisión del modelo ABC. Introducción en
el modelo ABC de los genes de la clase E.
Inicialmente los genes LFY, UFO y WUS se expresan
en dominios específicos del meristemo floral. Sus
productos desencadenan la activación de los genes
implicados en la determinación de la identidad de
cada órgano floral. Esto, junto con la represión de AP1
por AG, da lugar al patrón ABC en la flor (función A en
verde, función B en azul y función C en naranja). La
función de los genes SEP
se restringiría a los
verticilos segundo, tercero y cuarto, colaborando en la
generación de la identidad de los órganos florales. Se
cree que las proteínas SEP forman complejos
proteicos con los productos de los genes de identidad
B y C. Se, sépalos; Pe, pétalos; St Estambres; Ca,
carpelos. Tomado con modificaciones de Lohmann y
Weigel, 2002.
Introducción 24
I.6.3.4.- El desarrollo del fruto.
El fruto es un órgano con un alto grado de especialización que se desarrolla a
partir del pistilo, una vez que ha tenido lugar la fecundación. Las formas muy diversas
que presenta en las distintas especies están relacionadas con la función que
desempeña. Suministra un entorno adecuado para la formación de las semillas,
habiendo un estricto acoplamiento entre su desarrollo y el de éstas, y proporciona un
mecanismo eficaz para la propagación de las semillas. El fruto de Arabidopsis, al igual
que ocurre con las más de 3.000 especies de Brasicáceas, es un fruto dehiscente que
se desarrolla a partir de un gineceo formado por un pistilo bicarpelar. Esta clase de
frutos recibe el nombre de silicua (Ferrándiz et al., 1999; Fig. I.10).
A
estigma
estilo
B
valvas
ovario
replum
entrenudo
nectarios
Figura I.10.- Morfología del fruto de Arabidopsis. (A) Microscopía electrónica de barrido de un fruto de
Arabidopsis en estadio de antesis en el que se indican las distintas regiones del fruto que se observan
externamente. (B) Sección tranversal de un fruto en antesis. Se indican las distintas capas celulares. ex:
exocarpo; ms: mesocarpo; enb: capa más externa del endocarpo; ena: capa interna del endocarpo. En
cada uno de los dos lóculos (lc) se observan los óvulos (o). El tracto transmisor (tt) se localiza en la zona
media del septum (sp). Se indica la localización de los vasos laterales (lv) en las valvas, y los medios (mv)
en el replum (rp). Barra de escala 50 µm. Tomado de Ferrándiz et al., 1999.
El gineceo maduro de Arabidopsis está compuesto de un estigma apical, un
estilo corto y un ovario basal que contiene los óvulos. El estigma está formado por
numerosas células epidérmicas alargadas denominadas papilas estigmáticas,
especializadas en la adherencia del polen y la inducción de su germinación. En el
estigma comienza el tracto transmisor, un tejido rico en polisacáridos que dirige el
crecimiento del tubo polínico y continúa a lo largo del estilo y del septum del ovario
Introducción 25
para facilitar la fecundación de los óvulos. El estilo es una estructura corta, sólida y
cilíndrica formada por tejido transmisor rodeado de un anillo de haces vasculares. El
ovario consta de dos valvas separadas por el replum, y está dividido internamente en
el plano medio por el septum, que origina una cámara bilocular en la que se sitúan los
óvulos. El gineceo alcanza su madurez en el estadio de antesis, en el que se produce
la apertura de la yema floral y la dehiscencia de las anteras. En este momento, tiene
lugar la autopolinización, con lo que se inicia el desarrollo de la silicua, que se
distingue del pistilo por la aparición de estomas en la superficie del ovario. Existen
indicios de que en la fructificación hay una etapa inicial de divisiones celulares
(Martínez et al., 1992), obteniéndose la mayor contribución al tamaño final mediante la
elongación de las células (Bowman, 1994). Una vez que la silicua alcanza su longitud
final, empieza a diferenciarse la zona de dehiscencia, que consiste en una fina capa
de células situada entre la valva y el replum. La rotura de la lámina media situada
entre estas células, así como la lignificación de las células del margen de la valva,
permite la separación de la valva y el replum, con la consiguiente dispersión de las
semillas (Meakin y Roberts; 1990; Spence et al., 1996).
Durante los últimos años, se han descrito numerosas mutaciones que afectan
específicamente al desarrollo de los carpelos, así como otras que causan fenotipos
más pleiotrópicos. El estudio y caracterización de estos mutantes ha permitido la
identificación de genes implicados en la determinación de la identidad del carpelo,
como AG (véase apartado I.6.3.3), gen de la clase C esencial para la formación de los
carpelos (Yanofsky et al., 1990); SPATULA (SPT), un gen Myc cuyo producto se
necesita para que se produzca la fusión de los carpelos y la formación de los
conductos especializados en la guía del tubo polínico (Heisler et al., 1998; Álvarez y
Smyth, 1999), y CRABS CLAW (CRC), un gen de la familia YABBY que especifica un
destino celular abaxial en el carpelo (Bowman y Smyth, 1999; Álvarez y Smyth, 1999).
Otros genes están implicados en el establecimiento de la información posicional en el
primordio del carpelo o en su interpretación para generar las estructuras correctas.
ETTIN (ETT) codifica un producto con homología a las proteínas que se unen a
elementos de respuesta a auxinas y se ha propuesto que confiere identidad regional
en los meristemos florales, afectando entre otros órganos al pistilo (Sessions et al.,
1995; 1997). FUL (véase apartado I.6.3.3) se necesita para la diferenciación correcta
de las células de las valvas (Gu et al., 1998; Ferrándiz et al., 2000).
SHATTERPROOF1 (SHP1) y SHP2, pertenecientes a la familia de genes MADS,
actúan de manera redundante en la especificación de la zona de dehiscencia de los
frutos (Ferrándiz et al., 2000). En esta última función, participan también los genes
INDEHISCENT (IND) y ALCATRAZ (ALC; Rajani y Sundaresan, 2001; Liljegren et al.,
Introducción 26
2004), que codifican factores de transcripción de tipo básico hélice-bucle-hélice
(bHLH). El gen REPLUMLESS (RPL; Roeder et al., 2003) codifica un factor de
transcripción con homeodominio que se requiere para el desarrollo del replum. Los
genes TOUSLED (TSL; Roe et al., 1993; 1997a; 1997b), STYLISH1 (STY1) y STY2
(Kuusk et al., 2002) participan en la formación de los tejidos apicales del gineceo. Las
proteínas STY1 y STY2 poseen un dominio de localización nuclear y un motivo de
interacción con otras proteínas C3HC4 RING con dedos de zinc (Zinc binding C3HC4
RING finger motif), y el producto TSL presenta función quinasa de Ser/Thr.
A pesar de los extensos escrutinios que se han realizado, se han encontrado
muy pocas mutaciones cuyo fenotipo se halle restringido al carpelo. Esto se debe a
varias causas, entre las que podemos destacar la redundancia genética, la expresión
de un mismo gen en órganos distintos y el hecho de que, al ser los carpelos órganos
que derivan de las hojas, un gran número de genes implicados en el desarrollo del
carpelo también lo están en el desarrollo foliar (Bolker, 1995).
I.6.4.- El establecimiento de la polaridad en los órganos laterales.
Los órganos laterales, las hojas y los órganos florales, muestran un
crecimiento lateral y un desarrollo asimétrico. La relación entre el órgano lateral y el
meristemo apical a partir del cual se forma es la base para la definición de los tres ejes
primordiales. El eje próximo-distal está claramente definido por un borde proximal
unido al tallo y otro distal libre. La asimetría a lo largo del eje próximo-distal es patente
en las hojas, las cuales presentan un pecíolo proximal y una lámina foliar distal. Los
primordios también presentan un eje izquierda-derecha cuya relación posicional con el
meristemo no está clara, aunque puede tener relación con la filotaxia. El tercer eje, el
adaxial-abaxial, queda definido por la relación posicional entre el meristemo y el
primordio, que presenta una cara adaxial próxima al meristemo y otra abaxial más
alejada de éste.
Los primordios de los órganos laterales están inicialmente formados por unas
pocas células con histología uniforme y con una expresión génica aparentemente
homogénea. En estadios posteriores, cuando el primordio emerge de los bordes del
meristemo, la polaridad se hace evidente en términos de patrones de expresión de
genes y diferenciación morfológica. A pesar de que los órganos laterales tienen más
de dos tipos celulares, el establecimiento de la polaridad requiere tan sólo la formación
de dos poblaciones celulares distintas. Las interacciones posteriores entre estas dos
poblaciones generan los diferentes tipos celulares (Bowman et al., 2002).
Sussex (Sussex, 1954; 1955) y otros investigadores (Snow y Snow, 1959;
Hanawa, 1961) llevaron a cabo elegantes experimentos en los que practicaron
Introducción 27
incisiones que separaban el primordio emergente y el meristemo apical. El primordio
aislado del meristemo se desarrollaba con una simetría radial, aparentemente
abaxializado. Este resultado sugiere que el meristemo apical produce una señal
necesaria para la especificación correcta del eje adaxial-abaxial de los órganos
laterales. Una interpretación de este dato es que la señal que emana del meristemo
apical promueve la identidad adaxial en las células del primordio más cercanas a él.
En ausencia de esta señal, la identidad abaxial se diferencia como un estado por
defecto. Sussex también mostró que los primordios aislados que ya habían
comenzado
su
diferenciación
morfológica
eran
capaces
de
desarrollarse
autónomamente como hojas fenotípicamente normales. El desarrollo de los órganos
separados del meristemo como estructuras con simetría radial también implica que el
establecimiento de la polaridad adaxial-abaxial es un requerimiento para el crecimiento
lateral de la lámina foliar (Sussex, 1954; 1955). Recientes estudios en Arabidopsis y
Antirrhinum, recogidos en varias revisiones recientes (Eshed et al., 2001; Bowman et
al., 2002), han aportado datos acerca de los mecanismos genéticos y moleculares por
los que se establece la polaridad en los órganos laterales.
Waites y Hudson describieron el primer gen que formaba parte de la
maquinaria que controla la polaridad adaxial-abaxial, el gen PHANTASTICA (PHAN)
de Antirrhinum (Waites y Hudson, 1995). Se interpretó que las hojas radializadas de
los mutantes de pérdida de función phan estaban abaxializadas, en base a la
morfología de las células epidérmicas y a la posición del xilema respecto al floema.
Esta interpretación sugiere que la función de PHAN es la de promover la identidad
adaxial. El gen codifica un factor de transcripción de tipo MYB y su actividad es, al
menos, parcialmente redundante con la de HANDLEBARS (HB; Waites y Hudson,
2001), ya que el doble mutante phan hb presenta hojas y cotiledones completamente
abaxializados y carece de meristemo apical.
En contraste con las mutaciones phan de Antirrhinum, las mutaciones
semidominantes, de ganancia de función, en los genes PHABULOSA (PHB) y
PHAVOLUTA (PHV) de Arabidopsis causan la adaxialización dependiente de dosis de
los órganos laterales (McConnell y Barton, 1998; McConnell et al., 2001). Los órganos
laterales adaxializados de los homocigotos para el alelo semidominante phb-1d son
filamentosos y presentan simetría radial, lo que apoya la hipótesis formulada por
Sussex de que la yuxtaposición de los dominios adaxial y abaxial es necesaria para el
crecimiento lateral. PHB y PHV codifican miembros de la clase III de una familia de
factores de transcripción específicos de plantas que contienen un homeodominio y una
cremallera de leucina (factores de transcripción HD-ZIP III).
Introducción 28
PHB se expresa de forma homogénea en etapas muy tempranas de la
formación del primordio de la hoja y, con posterioridad, su expresión queda restringida
al dominio adaxial, cuando el primordio se distingue morfológicamente del meristemo.
McConnell y colaboradores sugirieron que PHB codifica un receptor de la señal que
emana del meristemo apical y establece el destino adaxial en los órganos laterales
(McConnell et al., 2001). En este escenario, la señal consistiría en un ligando cuya
concentración dependería de la proximidad al meristemo, que daría lugar a la
activación de la proteína PHB al unirse a ésta. La detección del mRNA de PHB en un
gradiente en el órgano lateral, con una concentración más elevada en las regiones
más adaxiales, sugiere que la acción del ligando es dependiente de dosis y que la
expresión del gen debería mantenerse mediante un bucle de retroalimentación
positiva.
Otra característica de los mutantes phb-1d es que presentan meristemos
axilares, que normalmente se sitúan en la axila adaxial de la hoja, alrededor de toda la
circunferencia de la base de las hojas adaxializadas. La presencia de estos
meristemos sugiere que su formación está asociada con el destino adaxial (Mc Connell
y Barton, 1998). La ausencia de meristemos axilares en mutantes de pérdida de
función en el gen REVOLUTA (REV), otro gen de la familia HD-ZIP III, puede, por
tanto, interpretarse como una pérdida parcial de la identidad adaxial (Talbert et al.,
1995; Ratcliffe et al., 2000; Otsuga et al., 2001).
Este modelo basado en una señal meristemática capaz de polarizar a los
órganos laterales predice una supresión, dependiente de concentración, de los
factores que promueven el destino celular abaxial por parte de los receptores de dicha
señal. En ausencia de la señal, por ejemplo cuando el primordio es separado del
meristemo, no se produce la activación de los factores adaxiales, lo que implica que
los factores que promueven el destino celular abaxial permanecen activos durante
todo el desarrollo del órgano lateral, con lo que la hoja se desarrolla con
características abaxiales uniformes. Los miembros de las familias génicas YABBY y
KANADI son candidatos a ser genes cuya función es la de promover la identidad
abaxial, dados los fenotipos de adaxialización que presentan los mutantes con alelos
nulos de estos genes y la abaxialización producida por la activación ectópica de varios
de estos genes (Eshed et al., 1999; 2001; Sawa et al., 1999; Siegfried et al., 1999;
Villanueva et al., 1999; Kerstetter et al., 2001; Fig. I.11).
La familia YABBY de Arabidopsis está formada por 5 genes que codifican
proteínas que probablemente actúan como factores de transcripción (Bowman y
Smyth, 1999; Eshed et al., 1999; Sawa et al., 1999a; 1999b; Siegfried et al., 1999;
Villanueva et al., 1999). Cada miembro de la familia se expresa de forma polar en uno
Introducción 29
o más órganos laterales. Tres de sus miembros −FILAMENTOUS FLOWER (FIL),
YABBY2 (YAB2) y YAB3− se expresan de forma polar en los órganos laterales
producidos por los meristemos apical y floral (Siegfried et al., 1999; Sawa et al., 1999).
Por el contrario, CRABS CLAW (CRC) e INNER NO OUTER (INO) están más
especializados, ya que su expresión se restringe a los carpelos y nectarios o a los
integumentos externos de los óvulos, respectivamente.
Los genes KANADI, miembros de la familia génica GARP, codifican
reguladores transcripcionales. Aunque la familia génica GARP es muy numerosa, sólo
tres de sus miembros −KANADI1 (KAN1), KAN2 y KAN3− parecen estar implicados en
promover el destino celular abaxial (Eshed et al., 1999; 2001; Kerstetter et al., 2001).
Se ha demostrado la participación de KAN1 y KAN2 en la inducción de la identidad
abaxial en los órganos laterales y en el integumento externo de los óvulos (Eshed et
al., 2001).
Tanto los factores que promueven la identidad adaxial como la abaxial se
expresan inicialmente en todo el primordio del órgano (McConnell et al., 2001;
Siegfried et al., 1999; Sawa et al., 1999a; 1999b; Kerstetter et al., 2001).
Posteriormente, conforme el primordio emerge del meristemo, los patrones de
expresión se restringen a sus respectivos dominios complementarios (McConnell et al.,
2001; Siegfried et al., 1999; Sawa et al., 1999a; 1999b; Kerstetter et al., 2001), lo que
es consistente con la adquisición temporal de la polaridad que se determinó en los
experimentos quirúrgicos (Sussex, 1954; 1955). Una posible hipótesis es que mientras
que PHB y otros genes HD-ZIP III se activan en la zona más cercana al meristemo por
señales derivadas de éste, la expresión de los genes KANADI y YABBY queda
reprimida en estas células. La formación de regiones complementarias se
fundamentaría en el antagonismo mutuo de los genes HD-ZIP III y KANADI, lo que
permitiría el establecimiento de los dominios adaxial y abaxial en los órganos en
desarrollo (Eshed et al., 2001; Kerstetter et al., 2001; McConnell et al., 2001; Fig. I.11).
Se ha observado en Arabidopsis que el mismo programa genético que
establece la polaridad adaxial-abaxial en los órganos laterales se encarga también de
generar el patrón que adopta el tejido vascular formado a partir del procámbium de un
órgano con simetría radial como el tallo, de tal forma que la posición interna que ocupa
el xilema equivale a identidad adaxial y la posición periférica del floema a identidad
abaxial (Tasaka 2001; Emery et al., 2003; Fig. I.11). Así, la señal derivada del
meristemo podría activar a los genes HD-ZIP III tanto en la región adaxial de la hoja
como en la región central del tallo (Emery et al., 2003).
Introducción 30
señal meristemática
(esterol?)
REV, PHB, PHV, CNA
KANADI
miRNA
adaxial, xilema
abaxial, floema
Figura I.11.- Establecimiento de los ejes adaxial-abaxial y central-periférico. Una señal que emana del
meristemo activa a los genes de la clase HD-ZIP III, que antagonizan con los genes de la familia KANADI.
Tanto los genes KAN como los microRNA 165/166 (miR165/166; véase el apartado I.6.5.2) regulan
negativamente a los genes HD-ZIP III, que promueven la identidad adaxial en los órganos laterales y el
xilema en los haces vasculares. Los genes KAN promueven identidad abaxial en los órganos laterales y
floema en los haces vasculares. Tomado con modificaciones de Emery et al., 2003.
I.6.5.- Los genes HD-ZIP.
Se denomina homeobox a una secuencia génica de 180 pares de bases que
codifica el homeodominio, un dominio proteico de unión a DNA que consta de 60
aminoácidos. El homeodominio está presente en muchas proteínas que participan en
el control genético del desarrollo de los organismos pluricelulares, actuando como
factores de transcripción (Gehring, 1992; Lawrence y Morata, 1994). La homeobox se
identificó por primera vez en los genes homeóticos de Drosophila melanogaster, de ahí
su denominación, que están implicados en conferir la identidad precisa a los
segmentos de la mosca (McGinnis et al., 1984; Scott y Weiner, 1984). El primer gen
con homeobox identificado en las plantas fue Knotted-1 (Kn1) de maíz (Vollbrecht et
al., 1991), que desempeña una función importante en el mantenimiento del meristemo
apical durante el desarrollo de la planta (Smith et al., 1992), al igual que sus ortólogos
en Arabidopsis, los genes KNOX de la clase I (véase el apartado I.6.2.1).
Para aislar los primeros genes con homeobox en Arabidopsis (genes ATHB,
de Arabidopsis thaliana homeobox genes), se llevaron a cabo escrutinios en
genotecas de cDNA, empleando sondas degeneradas derivadas de secuencias
conservadas en los homeodominios animales (Ruberti et al., 1991; Mattson et al.,
1992; Schena y Davis, 1992). Los genes obtenidos en estos escrutinios contenían,
además de la homeobox, secuencias que codificaban una cremallera de leucina, de
ahí el nombre de genes HD-ZIP. En el genoma de Arabidopsis se han identificado 42
genes con estas características (The Arabidopsis Genome Initiative, 2000), que se
agrupan en cuatro familias, HD-ZIP I-IV, en base a criterios de secuencia (Sessa et al.,
Introducción 31
1994). Parece que los genes pertenecientes a las familias I y II tienen un origen
común, mientras que las familias III y IV están más alejadas evolutivamente.
Poco tiempo después de haberlos hallado en Arabidopsis, se aislaron genes
HD-ZIP en especies vegetales como el tomate (Meissner y Theres, 1995), girasol
(Chan y González, 1994) y arroz (Meijer et al., 1997). Actualmente, conocemos la
presencia de estos genes en todas las plantas en las que se han buscado; y, por el
momento, no se han identificado en los animales, lo que parece indicar que los genes
HD-ZIP son específicos de las plantas.
Las cremalleras de leucina permiten la formación de dímeros, lo que sugiere
que las proteínas HD-ZIP podrían unirse al DNA como homo o heterodímeros. Esta
hipótesis se ha confirmado mediante experimentos in vitro con ATHB1 (HD-ZIP I) y
ATHB2 (HD-ZIP II). Con elevada probabilidad, estas proteínas son capaces de formar
homodímeros, ya que se unen al DNA a través de los sitios de unión
pseudopalindrómicos, CAAT(A/T)ATTG y CAAT(C/G)ATTG), respectivamente (Sessa
et al., 1993). Asimismo, se ha demostrado que ATHB9 (HD-ZIP III) se une
específicamente a la secuencia pseudopalindrómica GTAAT(G/C)ATTAC (Sessa et al.,
1998).
I.6.5.1.- Función de los genes HD-ZIP de Arabidopsis thaliana.
Los genes HD-ZIP participan en un gran número de procesos relacionados
con el crecimiento y el desarrollo vegetales. El gen ATHB1 participa en el desarrollo
foliar (Aoyama et al., 1995), y ATHB7, ATHB12 y ATHB6 son activados
transcripcionalmente en condiciones de estrés hídrico, así como cuando aumentan los
niveles de ácido abcísico (ABA; Söderman et al., 1996; 1999; Lee y Chun, 1998). La
expresión del gen ATHB2 se induce intensamente por longitudes de onda
pertenecientes al intervalo rojo-lejano del espectro luminoso (Carabelli et al., 1993;
1996). Este dato, junto con la evidencia del análisis de plantas transgénicas, sugiere
que ATHB2 participa en la respuesta dependiente de auxina que se desarrolla bajo
condiciones de sombra (Steindler et al., 1999). Los genes de la familia HD-ZIP III
regulan aspectos críticos del desarrollo vegetal como el establecimiento de la
polaridad de los órganos laterales, la formación de los meristemos apical y lateral y el
desarrollo vascular (véase el apartado I.6.5.2). Perteneciente a la familia HD-ZIP IV, el
gen ATHB10, también conocido como GLABRA2 (GL2; Rerie et al., 1994; Di Cristina
et al., 1996), se requiere para la correcta diferenciación de los tricomas y los pelos
radiculares
(Masucci
et
al.,
1996).
Otro
gen
de
la
familia
HD-ZIP
IV,
ANTHOCYANINLESS2 (ANL2), afecta a la acumulación de antocianinas y al
desarrollo de la raíz en Arabidopsis (Kubo et al., 1999).
Introducción 32
I.6.5.2.- La familia de genes HD-ZIP III.
La familia de los genes HD-ZIP III está formada por cinco miembros:
REVOLUTA/INTERFASCICULAR FIBERLESS1 (REV/IFL1), PHABULOSA (PHB;
ATHB14) y PHAVOLUTA (PHV; ATHB9), que forman un clado, siendo PHB y PHV
más parecidos entre sí, y ATHB8 y CORONA (CNA; ATHB15), que forman otro clado
(Fig. I.12). Hay un gran parecido en la secuencia de estos genes entre las distintas
especies vegetales, siendo un dato a destacar que más del 50% de la secuencia
aminoacídica está conservada entre la proteína PpHB10 del briófito Physcomitrella
patens y cada una de las proteínas HD-ZIP III de Arabidopsis (Sakakibara et al., 2001).
Figura I.12.- Filograma de los miembros de la
familia HD-ZIP III de Arabidopsis. PpHB10 es un
gen del briófito Physcomitrella patens que
pertenece a la familia HD-ZIP III. La barra de
escala representa 50 cambios. Tomado de
Emery et al., 2003
Las proteínas de la familia HD-ZIP III contienen un dominio HD-ZIP, implicado
en la unión a DNA y en la dimerización (Sessa et al.,1998), cerca del extremo terminal
amino; un dominio START de unión a esteroles y lípidos (steroidogenic acute
regulatory related lipid transfer; Ponting y Aravind, 1999), y un dominio conservado de
función desconocida cerca del terminal carboxilo (Green et al., 2005).
Se han aislado mutantes tanto de pérdida como de ganancia de función en
algunos de estos genes. Las mutaciones de pérdida de función rev causan defectos en
el desarrollo foliar y en la especificación de las células totipotentes, y alteran el
desarrollo vascular y el transporte de auxinas (Talbert et al., 1995; Zhong et al., 1997;
Zhong y Ye, 1999; Otsuga et al., 2001). Los mutantes homocigóticos para alelos de
pérdida de función athb8, phb, phv y cna no muestran fenotipos alterados, debido a la
redundancia funcional de estos genes (Baima et al., 2001; Prigge et al., 2005).
Como
se
ha
mencionado
en
el
apartado
I.6.4,
las
mutaciones
semidominantes, de ganancia de función, en los genes PHB y PHV resultan en
defectos en la polaridad adaxial-abaxial de los órganos laterales y en la formación de
meristemos en posiciones ectópicas (McConnell y Barton, 1998; McConell et al., 2001;
Tang et al., 2003). Mutaciones similares en el gen REV causan defectos de polaridad
Introducción 33
en los haces vasculares y en las hojas (Zhong et al., 1999; Emery et al., 2003; Zhong y
Ye, 2004). La sobreexpresión de ATHB8 en plantas transgénicas que contienen una
construcción con el cDNA del gen tiene como resultado una producción excesiva de
xilema (Baima et al., 2001).
Todas las mutaciones de ganancia de función descritas en los genes de esta
familia consisten en sustituciones de un solo nucleótido, que dan lugar a un cambio de
aminoácido o a una perturbación del procesamiento de los intrones que resulta en la
adición de unos pocos aminoácidos. Las mutaciones se sitúan en la región del dominio
START más cercana al extremo terminal amino, y producen la expresión ectópica de
los genes. Este dato llevó a la especulación de que los fenotipos de ganancia de
función observados eran debidos a la alteración en la percepción por el dominio
START de un ligando de tipo lipídico. Según esta hipótesis, las proteínas HD-ZIP III
podrían actuar como receptores de una hipotética señal adaxializante emanada del
meristemo. La unión del ligando lipídico al dominio START daría lugar a la activación
de estas proteínas y, mediante su autorregulación, a un mantenimiento de la expresión
de los genes específicamente en el dominio adaxial. La reciente identificación de una
secuencia complementaria a dos microRNA (miRNA), los miRNA 165/166, justo en la
región donde se localizan todas las mutaciones semidominantes sugiere que los
fenotipos mutantes generados por ellas pueden deberse a la alteración de un proceso
de regulación post-transcripcional de los genes HD-ZIP III mediado por interferencia
con miRNA (Reinhart et al., 2002; Rhoades et al., 2002; Tang et al., 2003). Diversos
trabajos demuestran que, en efecto, hay una regulación post-transcripcional in vivo de
los genes HD-ZIP III mediante miRNA (Emery et al., 2003; Floyd y Bowman, 2004;
Zhong y Ye, 2004; Kim et al., 2005).
I.6.6.- La regulación post-transcripcional mediada por microRNA.
Los miRNA son pequeños RNA no codificantes, de 18 a 25 nucleótidos de
longitud, que tienen la capacidad de regular post-transcripcionalmente la expresión
génica. Se forman a partir de precursores de mayor longitud que adoptan estructuras
secundarias complejas y son procesados por una ribonucleasa de tipo III que recibe el
nombre de Dicer en los animales (Bernstein et al., 2001) y DICER-LIKE1 (DCL1;
Jacobsen et al., 1999; Golden et al., 2002) en las plantas. La cadena antisentido del
miRNA maduro, que es la complementaria al mRNA diana, interacciona con un
complejo de gran tamaño (RISC, RNA-induced silencing complex) para regular
negativamente la expresión de su diana. Al contrario que en los animales, en las
plantas la complementariedad de la secuencia del miRNA y del mRNA diana es casi
perfecta y, generalmente, se produce la degradación del mRNA diana. No obstante, en
Introducción 34
el caso del mRNA del gen AP2 se ha descrito que el mecanismo inhibe la traducción, y
también se ha demostrado para los genes HD-ZIP III la metilación de regiones
situadas en la mitad de su secuencia que incluye el extremo 3’, que si bien se
desconoce con exactitud cuál es su efecto, se supone pueda tener incidencia sobre la
transcripción de los genes (Bao et al., 2004).
Recientemente, se han aislado varios miRNA en Arabidopsis, muchos de los
cuales regulan la expresión de genes que codifican factores de transcripción
implicados directa o indirectamente en aspectos concretos del desarrollo vegetal,
como el control de la floración, el mantenimiento de los meristemos y la especificación
de la polaridad de los órganos laterales. Entre estos miRNA se encuentran los
miRNA165 y miRNA166, que regulan la expresión de los genes HD-ZIP III (Rhoades et
al., 2002; Aukerman y Sakai, 2003; Emery et al., 2003; Palatnik et al., 2003; Tang et
al., 2003; Chen, 2004; Floyd y Bowman, 2004; Juarez et al., 2004a; Kidner y
Martienssen, 2004; Laufs et al., 2004; Mallory et al., 2004a; McHale y Koning, 2004;
Zhong y Ye, 2004; Vaucheret et al., 2004; Kim et al., 2005). La regulación mediante
miRNA de los genes HD-ZIP III opera en una gran cantidad de especies vegetales,
desde briófitos a monocotiledóneas, lo que indica que el mecanismo surgió hace más
de 400 millones de años (Floyd y Bowman, 2004).
Se han aislado varios genes de Arabidopsis que participan en el metabolismo
de los miRNA. DCL1 se requiere para la acumulación de los miRNA maduros y tiene
una función importante en diferentes estadios del desarrollo, desde la embriogénesis a
la floración y la formación de los órganos laterales (Robinson-Beers et al., 1992;
Jacobsen et al., 1999; McElver et al., 2001). HUA ENHANCER1 (HEN1) codifica una
proteína de pequeño tamaño, sin ningún dominio funcional conocido, que se requiere
también para la acumulación de los miRNA maduros, para lo cual colabora con DCL1
(Park et al., 2002). Mutaciones de pérdida de función en HEN1 causan la disminución
general del tamaño de la planta y de todos sus órganos, la alteración de la morfología
foliar, la reducción de la fusión de los carpelos y transformaciones homeóticas en los
órganos florales en un fondo genético mutante hua1-1 hua2-1 (Chen y Meyerowitz,
1999; Chen et al., 2002). El gen HYPONASTIC LEAVES1 (HYL1; Lu y Fedoroff, 2000)
codifica una proteína de unión a RNA de doble cadena que también colabora con
DCL1 en la producción de los miRNA maduros. La pérdida de función de este gen
produce un fenotipo muy pleiotrópico, que incluye un incremento de la sensibilidad al
ácido abscísico, la reducción de la sensibilidad a auxinas y citoquininas y anomalías
en el desarrollo, como la simplificación del patrón vascular y la presencia de hojas con
los márgenes foliares curvados hacia el haz. Estos dos últimos fenotipos pueden
deberse a la disminución en la cantidad de miR165/166, lo que conlleva un aumento
Introducción 35
en la expresión de genes HD-ZIP III (Yu et al., 2005).
ARGONAUTE1 (AGO1) y PINHEAD (PNH) pertenecen a una familia génica
muy conservada, cuyos miembros están implicados en el silenciamiento génico
mediante miRNA en diferentes organismos. Las mutaciones de pérdida de función en
estos genes tienen como resultado la formación de órganos laterales parcialmente
abaxializados y la disminución de la formación o la actividad de los meristemos
(McConnell y Barton 1995; Bohmert et al., 1998; Moussian et al., 1998; Lynn et al.,
1999). Aunque se duda de la participación del producto PNH en el metabolismo de los
miRNA, la proteína AGO1 es un componente esencial del complejo RISC.
HASTY (HST) es el ortólogo en Arabidopsis del gen que codifica la Exportina 5
de mamíferos, la proteína encargada de exportar los precursores de los miRNA del
núcleo al citoplasma y de la estabilización de los mismos (Telfer y Poethig, 1998;
Bohnsack et al., 2002; Calado et al., 2002; Bollman et al., 2003; Yi et al., 2003;
Bohnsack et al., 2004; Zeng y Cullen, 2004). Las mutaciones de pérdida de función en
este gen reducen la acumulación de miRNA (Park et al., 2005), y afectan a la
morfología del meristemo apical del tallo, alteran la filotaxia de la inflorescencia,
adaxializan los órganos laterales y adelantan el cambio de la fase juvenil a la adulta
(Telfer y Poethig, 1998; Bollman et al., 2003). Un trabajo reciente indica que, en
Arabidopsis, los miRNA maduros se producen en el núcleo, de forma que la proteína
HST no exportaría los precursores de los miRNA, sino los productos ya maduros (Park
et al., 2005).
II.- Antecedentes y objetivos
Antecedentes y objetivos 37
II.- Antecedentes y objetivos
El objetivo de los estudios sobre el desarrollo de los organismos pluricelulares
es el de dar respuestas a cuestiones del tipo de cómo, partiendo de un primordio con
un número limitado de células, se establecen patrones concretos de división,
expansión y diferenciación que dan lugar a la producción de órganos en posiciones
precisas. Estos fenómenos están controlados genéticamente, por lo tanto, una
cuestión clave a resolver es la de la identidad de los genes que dirigen y llevan a cabo
tales procesos. Los estudios de desarrollo en las plantas, antaño limitados a la mera
descripción de las estructuras y a determinadas pruebas bioquímicas y fisiológicas,
también han hecho suyas estas mismas preguntas y estrategias, e incluyen
actualmente la utilización de herramientas genéticas y moleculares.
El análisis genético de los fenómenos de desarrollo tiene como punto de
partida la búsqueda de mutantes morfológicos, que se distinguen de las estirpes
silvestres por presentar formas anormales. Estos mutantes nos permitirán identificar
los genes que regulan la división y la diferenciación coordinada de células durante el
proceso de desarrollo en estudio, así como inferir la función de los alelos silvestres a
partir de la visualización de los fenotipos causados por los alelos alterados.
En nuestro laboratorio, se está realizando un esfuerzo para contribuir a la
comprensión de los fenómenos de desarrollo implicados en la formación del fruto de la
planta modelo Arabidopsis thaliana. El fruto se forma a partir del pistilo, tras la
polinización, como vía alternativa a la senescente que tiene lugar en ausencia de
fertilización. Posiblemente, se trata del más complejo de los órganos de Arabidopsis,
tanto en su función como en su anatomía, habiéndose descrito numerosos elementos
de patrón a lo largo de los ejes apical-basal y adaxial-abaxial cuyos procesos de
desarrollo son susceptibles de ser analizados mediante estrategias genéticas y
moleculares. El programa complejo que da lugar a la producción de los frutos los
convierte, por tanto, en sistemas de gran potencial para el estudio de los fenómenos
básicos de morfogénesis en las plantas. Por otro lado, conocido el indudable valor
agrícola de estos órganos en muchas especies, cabe esperar que el establecimiento
de la base genética y molecular de los procesos implicados en el desarrollo del fruto
permita sentar los cimientos de futuros experimentos de manipulación genética,
encaminados a la modificación controlada de la forma y el tamaño de frutos de interés.
Los trabajos recogidos en dos revisiones evidencian la excelencia de
Arabidopsis para el análisis de los mecanismos de desarrollo que conducen a la
Antecedentes y objetivos 38
formación del pistilo y el fruto (Bowman et al., 1999; Ferrándiz et al., 1999). La
obtención de mutantes ha permitido la identificación de varios genes maestros,
muchos de ellos ya clonados y caracterizados molecularmente. Éstos codifican
factores de transcripción, implicados en la regulación transcripcional de otros genes,
proteínas que funcionan en procesos de regulación post-transcripcional, o quinasas,
que posiblemente participan en rutas de señalización y transducción de señales. No
obstante, a pesar del notable esfuerzo realizado hasta la fecha, se supone que son
muchos los genes aún sin caracterizar y, en todo caso, todavía quedaría por
determinar de qué forma estarían interaccionando los genes implicados.
En una publicación realizada unos meses antes del comienzo del trabajo
recogido en esta memoria (Serrano-Cartagena et al., 2000), se describía como
sinérgico el fenotipo del doble mutante hasty-5 incurvata4-1 (hst-5 icu4-1). HST es el
ortólogo en Arabidopsis del gen que codifica la Exportina 5 de mamíferos, que se
encarga de exportar los microRNA (miRNA) del núcleo al citoplasma (véase apartado
I.6.6; Telfer y Poethig, 1998; Bollman et al., 2003). INCURVATA4 (ICU4) era un gen de
naturaleza molecular desconocida, cuyo locus se situó en el cromosoma 1, 31,5 ± 7,0
cM por debajo del marcador T27K12-Sp6 y 16,9 ± 4,5 cM sobre el marcador nga128
(Serrano-Cartagena et al., 2000). El fenotipo de este doble mutante consistía en la
extrema curvatura de sus hojas vegetativas, una reducción muy acusada del tamaño
de la planta, un retraso del tiempo de floración y la formación eventual de rosetas
aéreas (Serrano-Cartagena et al., 2000).
Al ser los carpelos órganos que derivan de las hojas, un gran número de
genes implicados en el desarrollo del carpelo también lo están en el desarrollo foliar
(Bolker, 1995). De hecho, los mutantes de pérdida de función para el gen HST,
además de mostrar hojas curvadas hacia el haz, un fenotipo que ha recibido la
denominación de Incurvata (Berná et al., 1999; Serrano-Cartagena et al., 2000),
muestran alteraciones evidentes en el desarrollo de los carpelos y los frutos formados
a partir de éstos (Serrano-Cartagena et al., 2000; Bollman et al., 2003). Por lo tanto,
teniendo en cuenta que los mutantes con los alelos semidominantes icu4-1 e icu4-2
comparten el fenotipo Incurvata con los homocigotos para alelos nulos en el gen HST,
así como las características previamente descritas del doble mutante, nos planteamos
como primer objetivo determinar si se observaba también sinergia respecto al fenotipo
de los carpelos y los frutos de los dobles mutantes; y, en tal caso, intentar dilucidar la
naturaleza de la alteración y la posible función del gen ICU4 en el desarrollo de estos
órganos, en particular, y en el de los órganos laterales, en general.
Una vez establecido el proceso concreto de desarrollo afectado en los
órganos laterales de los mutantes icu4, un segundo objetivo era el de realizar una
Antecedentes y objetivos 39
caracterización fenotípica exhaustiva de los mutantes, desde la embriogénesis al
tiempo de floración, así como la filotaxia y la formación de patrones vasculares, lo que
sin duda contribuiría a una mayor comprensión de la implicación del gen ICU4 en el
desarrollo de Arabidopsis.
El tercer objetivo que nos planteamos fue la clonación e identificación
molecular del gen ICU4, y su posible inclusión dentro de alguna familia génica
conocida cuyos miembros pudieran participar en los mismos procesos en los que
estuviera implicado ICU4. La verificación de la identidad de un posible gen candidato
con ICU4 se realizaría mediante la identificación de las mutaciones presentes en los
alelos icu4-1 e icu4-2, comparando sus secuencias con las del ecotipo silvestre En-2, y
mediante la obtención de plantas transformantes portadoras de construcciones
moleculares para el gen candidato. Una vez caracterizado el gen, la determinación del
patrón de expresión aportaría información adicional sobre su función.
Finalmente, como cuarto objetivo, se asumió el análisis de interacciones
adicionales entre el gen ICU4 y otros genes ya descritos que participaran en los
procesos de desarrollo afectados en los mutantes icu4. Con ello, se pretendía
profundizar en el conocimiento de la función del gen y, eventualmente, poder incluirlo
en algún modelo que permitiera explicar la participación de ICU4 y otros genes en el
desarrollo de Arabidopsis.
III.- Materiales y Métodos
Materiales y Métodos 41
III.- Materiales y Métodos
III.1.- Organismos utilizados en este trabajo.
III.1.1.- Estirpes de Arabidopsis thaliana.
III.1.1.1.- Estirpes silvestres.
Las estirpes silvestres de Arabidopsis thaliana utilizadas en esta Tesis son
Enkheim-2 (En-2, N1138), Columbia-0 (Col-0, N1092), Landsberg erecta (Ler, NW20)
y Nossen-0 (No-0, N1394). Todas ellas se han obtenido del centro de distribución de
semillas existente en Europa (NASC, Nottingham Arabidopsis Stock Center, Norwich,
Reino Unido).
III.1.1.2.- Estirpes mutantes.
III.1.1.2.1.- Nomenclatura utilizada en la denominación de genes, mutaciones y
fenotipos.
Durante la realización del presente trabajo se han seguido las directrices
propuestas por Meinke y Koornneef (1997) para Arabidopsis respecto a la
denominación de genes, mutantes y fenotipos. De forma continua, podemos encontrar
actualizaciones
de
esta
normativa
en
la
dirección
de
Internet
http://mutant.Lse.okstate.edu/genepage/namerule.html. Los genes se nombran con su
nombre completo en mayúscula y con letra cursiva, o con una abreviatura de tres
letras mayúsculas y cursivas. Los alelos de un gen se indican mediante el nombre
completo del gen o una abreviatura de tres letras de éste, siempre en letra cursiva, con
mayúsculas en el caso del alelo silvestre y minúsculas si se trata de un alelo mutante.
Los distintos alelos mutantes de un gen se denotan utilizando números separados por
un guión, que indican habitualmente el orden de aislamiento. La proteína codificada
por el gen se expresa mediante la misma abreviatura con letras mayúsculas y en
tipografía normal. Para referirnos a un fenotipo mutante, se escribe la abreviatura del
gen en tipografía normal y con la letra inicial en mayúsculas.
La anotación de los genes en el genoma de Arabidopsis se ajusta a la
nomenclatura determinada por el AGI (The Arabidopsis Genome Initiative, 2000). Por
ejemplo, At1g52150 hace referencia al gen numerado como 52.150 en el cromosoma I
Materiales y Métodos 42
de Arabidopsis. Versiones actualizadas de las anotaciones se pueden encontrar en
http://www.arabidopsis.org/info/guidelines.jsp#alia.
III.1.1.2.2.- Procedencia de las estirpes mutantes.
Todas las estirpes mutantes utilizadas en este trabajo se describen en la Tabla
III.1, con indicación de su fondo genético, del mutágeno utilizado para provocar la
mutación y de su procedencia. Como se puede ver en esta tabla, la mayoría de las
estirpes mutantes proceden del NASC y el resto nos han sido suministradas
directamente por el autor que publicó dicha estirpe, excepto athb8-6 que pertenece a
la colección GABI-Kat de líneas de inserción de T-DNA (línea GABI_256E07).
Tabla III.1.- Estirpes mutantes utilizadas durante el desarrollo de esta Tesis.
Alelo
Fondo
genético
Código
NASC
Mutágeno
Referencia
as1-1
Col-1
N3374
Rayos-X
Redei, 1965
athb8-6
Col-0
-
T-DNA
bp-1
Ler
NW30
EMS
Koornneef et al., 1983
crc-1
Ler
N3814
EMS
Álvarez y Smyth, 1999
fil-3
Ler
-
EMS
Chen et al., 1999
hst-1
Ler
N3811
Diepoxibutano
Telfer y Poethig, 1998
icu4-1
En-2
N400
?
Serrano-Cartagena et al.,2000
icu4-2
En-2
N401
?
Serrano-Cartagena et al.,2000
icu4-4
Col-0
N513134
T-DNA
Alonso et al., 2003
icu4-5
Col-0
N545175
T-DNA
Alonso et al., 2003
kan1-2
Ler
-
EMS
Eshed et al., 1999
pkl-1
Col
N3840
EMS
Ogas et al., 1997
phb-1d
Ler
N3761
EMS
McConnell y Barton, 1998
pnh-2
Ler
N3853
EMS
McConnell y Barton, 1995
pny-40126
Col-0
N540126
T-DNA
Smith et al., 2003
rev-1
No-0
N3826
EMS
Talbert et al., 1995
rev-6
Col-0
-
EMS
Pogany et al., 1998
Rosso et al., 2003; Sthrizov et
al., 2003; Li et al., 2003
Materiales y Métodos 43
III.1.2.- Estirpes de Escherichia coli.
Se utilizaron las estirpes DH10β (Choi et al., 1995) y DH5α (Hanahan et al.,
1983) de E. coli. Ambas dan lugar a complementación α (Φ80dlacZ∆M15), lo que
permite la selección de colonias blancas/azules para la identificación de las bacterias
portadoras de plásmidos recombinantes, y son incapaces de recombinar (recA-). Los
experimentos de transformación se llevaron a cabo mediante choque térmico (DH5α) o
electroporación (DH10β).
La estirpe DH10β es portadora de clones PAC (P1 Artificial Chromosome)
procedentes de la genoteca IGF (Institut für Genbiologische Forschung, Berlin GMBH),
depositadas en el ABRC. El clon F5F19, que contiene el gen ATHB15 (At1g52150), se
generó utilizando el vector pBeloBAC-Kan (Mozo et al., 1998) que confiere resistencia
al antibiótico kanamicina.
III.1.3.- Estirpes de Agrobacterium tumefaciens.
Se han utilizado en este trabajo dos estirpes de Agrobacterium tumefaciens:
C58C1 (Zambrisky et al., 1983; Koncz et al., 1986) y LBA4404 (Hoekeman et al.,
1983). La primera carece de plásmido Ti, mientras que la segunda presenta
modificaciones respecto a la estructura original del mismo. Dado que ambas estirpes
tienen resistencia cromosómica a la rifampicina, siempre se cultivaron en presencia de
este antibiótico, impidiendo así la proliferación de otro tipo de microorganismos. Se
generaron células competentes de ambas estirpes para someterlas a transferencia de
DNA mediante electroporación.
III.2.- Vectores. Plásmidos y construcciones.
En este apartado se incluyen los vectores utilizados en los trabajos rutinarios
de clonación y los empleados en experimentos de transformación de plantas, tanto en
la creación de las distintas colecciones de mutantes por mutagénesis insercional de TDNA (generadas en otros laboratorios) como en los experimentos llevados a cabo
durante esta Tesis.
En todos los experimentos de subclonación o transcripción in vitro se han
empleado los plásmidos pGEM-3Zf(+) y pGEM-T (Promega, USA).
El plásmido pROK2 (Baulcombe et al., 1986) fue la herramienta elegida en la
obtención de la colección SALK de líneas de plantas con inserciones de T-DNA
(Alonso et al., 2003). La inserción confiere a las plantas portadoras resistencia a la
kanamicina, propiciada por el gen nptII.
Materiales y Métodos 44
El cDNA completo del gen ATHB15 se obtuvo a partir de la colección de
clones de cDNA de Arabidopsis thaliana generada en el Instituto RIKEN Genomics
Sciences Center (Seki et al., 1998; 2002). Este cDNA estaba clonado en el plásmido
RAFL7, una modificación a partir del plásmido bluescript 2, que confiere resistencia a
ampicilina.
Para los experimentos de sobreexpresión génica en las plantas hemos
utilizado el vector pBIN-JIT (Ferrándiz et al., 2000; Fig. III.1), un vector de 13 Kb
derivado del pBIN19, que contiene tanto el T-DNA como los genes necesarios para su
integración. También presenta dos copias del promotor 35S del virus del mosaico de la
coliflor (35S CaMV). Para la obtención de la construcción de interferencia se ha
utilizado el plásmido pCF6 (Cristina Ferrándiz), obtenido mediante la clonación del
sexto intrón del gen FUL en el plásmido pGEM-T.
pBIN-JIT
(13 Kb)
Figura III.1.- Plásmido pBIN-JIT. Incorpora un T-DNA modificado que presenta dos copias del promotor
35S del virus del mosaico de la coliflor (35SCaMV) y el terminador del gen de la nopalina sintetasa (nosT)
flanqueando el sitio clonación (recuadro). El gen nptII (neomicina fosfotransferasa II) confiere resistencia a
la kanamicina. Se indica como RB y LB los bordes derecho e izquierdo del T-DNA, respectivamente.
III.3.- Oligonucleótidos empleados como cebadores.
Todos los oligonucléotidos empleados en esta Tesis han sido sintetizados en
la empresa TIB-MOL-BIOL (Alemania) en la escala 0,01 µM, con grado de purificación
máximo (HPR3), y se indican en la tabla III.2.
Materiales y Métodos 45
Tabla III.2.- Oligonucleótidos empleados durante el desarrollo de esta Tesis.
Plásmido
o BAC
Posición en el
BAC (nucleótidos)
Enzima
GGAACTTCTTCCATCTCGGTG
F5F19
33914-33935
-
CER452458R
GTTGTTGTTGGTAAGACTGTC
F5F19
34053-34034
-
F5F19-1
TGATACATGTTATGTTTTCAGAC
F5F19
104674-104651
-
F5F19-2
CTTCAACAGCTCGACATTCG
F5F19
104217-104237
-
F5F19-3
TACAGGTTGCAGAGATTGTC
F5F19
104260-104280
-
F5F19-4
CCACTGGAAAGCATCTCTGC
F5F19
103828-103848
-
F5F19-5
TGGTCCTAGTATGCCACTGG
F5F19
103884-103864
-
F5F19-6
CCCCACCCATTAACACTAC
F5F19
103443-103462
-
F5F19-7
TTGATGCGTATCTAGCAGCAGCAG
F5F19
102968-102944
-
F5F19-8
GCAAACGAAGCATCGATTGGAGC
F5F19
102531-102554
-
F5F19-9
GCATGTCAAGTCCCACCTGG
F5F19
101731-101751
-
F5F19-10
TAGTCGACTGTGATTTGTGAAGCTACTCC
F5F19
105670-105656
SalI
F5F19-11
TAGGATCCCTTCGGTTCTGAAACCACAC
F5F19
105241-105251
BamhI
F5F19-12
TACTCGAGTGTGATTTGTGAAGCTACTCC
F5F19
105670-105656
XhoI
F5F19-13
TAAGATCTCTTCGGTTCTGAAACCACAC
F5F19
105241-105251
BglII
F5F19-14
ATGTCGACGCCAGCTCGAATTCGTCGAG
-
SalI
F5F19-15
GGCCCTTATGGCCGGATCCAAGAGC
-
-
F5F19-16
ATGGAATGAAGCCTGATCCGGATTCCATTGG
-
-
F5F19-17
CCAATGGAATCCGGATCAGGCTTCATTCCAG
-
-
F5F19-20
TGGACTAAGAAGCTCTCTGTC
F5F19
105596-105575
-
F5F19-21
ACATGACCGTTTTACAATACAGC
F5F19
101334-101357
-
F5F19-22
CACAGCTTGAACAACTACC
F5F19
105606-105615
-
F5F19-24
GTTGCCATGAACGAGCTAGAGG
F5F19
106264-106242
-
F5F19-27
TTGTCGACACAGAATCACCGAGTTGACTCAGC
F5F19
105979-105956
SalI
F5F19-28
TTGGGCCCCGACGAGCTTTGAGATCATTAGAG
F5F19
108069-108046
ApaI
F5F19-R1
CATGTAACCACTGGTAAGACTC
F5F19
100459-100481
-
M13F
GTAAAACGACGGCCAGTG
Universal
-
-
M13R
GGAAACAGCTATGACCATG
Universal
-
-
SALKLBb1
AACCAGCGTGGACCGCTTGCTG
pBIN-ROK
-
-
Nombre
Secuencia (5’-3’)
CER452458F
a
RAFL0935-K18
RAFL0935-K18
RAFL0935-K18
RAFL0935-K18
A algunos cebadores se les ha añadido la secuencia diana de una enzima de restricción.
a
Materiales y Métodos 46
III.4.- Medios de cultivo, disoluciones y tampones.
Para la preparación de las distintas soluciones se ha empleado agua
desionizada, obtenida con una resistividad de 15 MΩ mediante un purificador Millipore
(MilliRX).
Para la esterilización se ha utilizado un autoclave Presoclave 75 (Selecta),
sometiendo las soluciones a una presión de 1 atmósfera y 121ºC durante 20 min. Para
la esterilización de las soluciones termolábiles se empleó filtración mediante filtros
Millipore de 0,45 µm, 0,22 µm y 0,025 µm.
III.4.1.- Medios de cultivo.
III.4.1.1- Medios de cultivo para Arabidopsis thaliana.
III.4.1.1.1.- Medio de cultivo líquido.
Los cultivos en maceta se irrigaron con medio mínimo ATM (Arabidopsis
thaliana Medium), cuya composición es la siguiente: KNO3 5mM; KH2PO4 2,5 mM;
MgSO4 2 mM; Ca(NO3)2 2 mM; FeNaEDTA 51 mM; H3BO3 70 mM; MnCl2 14 mM;
CuSO4 0,5 mM; ZnSO4 1 mM; NaMoO4 0,2 mM; NaCl 10 mM; CoCl2 0,01 mM (Kanz y
Kirchheim, 1987).
III.4.1.1.2.- Medio de cultivo sólido.
Para la preparación de medio de cultivo sólido, se añadió agar bacteriológico
europeo (Scharlau, concentración final de 0,8% m/v) al resto de los componentes ya
disueltos en agua (medio GM). Tras su esterilización en autoclave, se dejó atemperar
el medio a 55ºC, se agregaron los antibióticos en aquellos casos en los que fue
necesario, y se realizó el vertido en placas de Petri. Las placas se almacenaron
precintadas a 4ºC.
Medio GM: NH4NO3 10,3 mM; H3BO3 50,1 mM; CaCl2 1,5 mM; CoCl2·6H2O 50
nM; Na2EDTA 55,4 µM; MgSO4 0,75 mM; MnSO4·H2O 50 µM; NaMoO4·2H2O
0,5 µM; KNO3 9,4 mM; KH2PO4 0,62 mM; ZnSO4·7H2O 15 µM; sacarosa 29,2
mM; MES [ácido 2-(N-morfolino)-etanosulfónico] 2,3 m; pH 5,7; agar 0,8%
(m/v).
Materiales y Métodos 47
III.4.1.2.- Medios de cultivo para microorganismos.
III.4.1.2.1.- Medio de cultivo líquido.
LB (Luria-Bertani): NaCl 1% (m/v), extracto de levadura 0,5% (m/v, Scharlau),
bacto-triptona 1% (m/v, Scharlau), pH 7,5. Para el cultivo de Agrobacterium
tumefaciens, se enriqueció el medio con glucosa 0,5% (m/v).
III.4.1.2.2.- Medio de cultivo sólido.
Para la elaboración de medios de cultivo sólidos se agregó agar bacteriológico
europeo (Scharlau) a una concentración final del 1,5% (m/v) al medio líquido LB. Las
placas se almacenaron precintadas a 4ºC.
III.4.1.3.- Medios de cultivo con antibióticos.
En determinadas ocasiones, se añadió antibiótico a los medios de cultivo
anteriormente descritos. Los antibióticos que se han utilizado en esta Tesis se
muestran en la Tabla III.3.
Tabla III.3.- Antibióticos utilizados durante el desarrollo de esta Tesis.
Antibiótico
Solvente
Concentración de la
solución madre
(mg/ml)
Concentración
final (µg/ml)
Temperatura de
almacenamiento
(ºC)
Ampicilina
H2O
100
100
-20
Carbenicilina
H2O
50
50
-20
Higromicina
H2O
20
20
4
Kanamicina
H2O
50
50
-20
Rifampicina
DMSO
50
50
-20
Tetraciclina
H2O
12,5
12,5
-20
III.4.2.- Disoluciones y tampones.
III.4.2.1.- Disoluciones de uso común.
SDS 20%
20X SSC: NaCl 3 M, citrato sódico 0,3 M y ajustando el pH a 7,0.
TE pH 8: Tris-HCl 10 mM pH 8, Na2EDTA 1 mM, pH 8.
Materiales y Métodos 48
III.4.2.2.- Disoluciones para el aislamiento de DNA genómico de Arabidopsis
thaliana.
Tampón de lisis 10X: NaCl 3,5 M, Tris-HCl 10 mM pH 7,6, Na2EDTA 10 mM
pH 8.
Tampón de extracción: Tampón de lisis 1X, Na2EDTA 50 mM pH 8, urea 7
M, sarkosyl (N-dodecanoil-N-metilglicina, sal sódica) 2%. Se prepara
inmediatamente antes de su uso.
III.4.2.3.- Disoluciones empleadas en el aislamiento de DNA plasmídico.
STE: NaCl 0,1 M, Tris-HCl 10 mM (pH 8) y Na2EDTA 1 mM (pH 8).
Solución I o de resuspensión: glucosa 50 mM, Tris-HCl 25 mM, Na2EDTA
10 mM.
Solución II o de lisis: Preparada en el momento de su utilización. SDS 1%
(v/v), NaOH 0,2 M.
Solución III o de neutralización: acetato potásico 3 M, ácido acético 11,5 %
(v/v).
III.4.2.4.- Disoluciones utilizadas en electroforesis.
50X TAE: Tris-HCl 2 M, ácido acético 5,71%, EDTA 50 mM, pH 8,0.
10X TBE: Tris-HCl 0,89 M, BO3H3 0,89 M, Na2EDTA 20 mM, pH 8,0.
Tampón de carga para electroforesis en geles de poliacrilamida en
condiciones desnaturalizantes: glicerol al 30% (v/v), azul de bromofenol
0,25% (m/v), xilene de cianol 0,25% (m/v), formamida desionizada 50% (v/v).
Tampón
de
carga
para
electroforesis
en
geles
de
agarosa
y
poliacrilamida en condiciones no desnaturalizantes: glicerol al 30% (v/v),
azul de bromofenol 0,25% (m/v), xilene de cianol 0,25% (m/v).
III.4.2.5.- Disoluciones empleadas en la identificación de clones bacterianos
mediante hibridación.
Solución de lavado: 2X SSC, SDS 0,1%.
Solución de desnaturalización: NaCl 1,5 M, NaOH 0,5 M.
Solución de neutralización: NaCl 1,5 M, Tris-HCl 0,5 M, pH 7,5.
Solución de prehibridación: Na2HPO4 250 mM, SDS 7%, EDTA 1 mM,
agente bloqueante 0,5% (m/v, Roche Diagnostics), pH 7,2.
Solución de hibridación: solución de prehibridación junto a una sonda de
DNA a una concentración de 20 ng/ml.
Materiales y Métodos 49
Tampón maleico: ácido maleico 150 mM, NaCl 125 mM, Tween 20 0,3%
(v/v, Sigma-Aldrich), pH 8.
Solución bloqueante: agente bloqueante 0,5% (m/v, Roche Diagnostics) en
tampón maleico.
Tampón de detección colorimétrica: Tris-HCl 0,1 M, NaCl 0,1 M, MgCl2 50
mM, pH 9,5.
III.4.2.6.- Disoluciones utilizadas en la hibridación in situ de tejidos.
20X SSC.
Solución para el anticuerpo y los lavados: 1X TBS, BSA 5% (m/v), Tritón
X-100 0,3% (v/v).
Solución de prehibridación: 6X SSC, SDS 1,5% (m/v), formamida 50%
(v/v), tRNA de levadura (100 µg/ml).
Solución de hibridación: Solución de prehibridación junto a una ribosonda a
una concentración particular.
20X PBS: NaCl 2,75 M, KCl 50 mM, Na2HPO4 200 mM y KH2PO4 35 mM (pH
7,4).
Tampón para proteinasa K (5X): Tris-HCl 0,5 M, Na2EDTA 250 mM, pH 8,0.
10X TBS: Tris-HCl 1 M, NaCl 4 M, pH 7,5.
Solución bloqueante con TBS: 1X TBS y agente bloqueante 0,5% (m/v,
Roche Diagnostics).
Tampón de detección A 10X: Tris-HCl 1 M, NaCl 1M, pH 9,5.
Tampón de detección B 10X: MgCl2 0,5 M.
Tampón de detección: tampón A 1X + tampón B 1X.
III.4.2.7.- Disolución
para
la
infiltración
de
plantas
con Agrobacterium
tumefaciens.
Se resuspendieron los cultivos bacterianos en sacarosa 5% (m/v, preparada
inmediatamente antes de su uso) hasta alcanzar una A600 de 0,8 y se añadió el
detergente Silwet-L77 0,035% (v/v, Lehle Seeds).
III.4.2.8.- Disolución de esterilización de semillas de Arabidopsis thaliana.
NaClO 5% (v/v, a partir de lejía comercial), Tritón X-100 0,003% (v/v).
Materiales y Métodos 50
III.4.2.9.- Sustrato para cultivo de Arabidopsis thaliana en maceta.
Perlita (granulometría de 1 a 3 mm; 105-125 kg/m3; Asfaltex S.A.), vermiculita
(granulometría de 0 a 3 mm; 80-100 kg/m3; Asfaltex S.A.), y turba no fertilizada (turba
rubia de musgo Sphagnum de estructura gruesa; Kekkilä OY, Tuusula, Finlandia) en
proporción 2:2:1. La mezcla se esterilizó en el autoclave.
III.5.- Condiciones y métodos de cultivo.
III.5.1.- Condiciones y métodos de cultivo para Arabidopsis thaliana.
III.5.1.1.- Cultivos en placas de Petri.
Tras esterilizar las semillas, mediante 8 min en la solución de esterilización
reseñada en el apartado III.4.2.8 y tres enjuagues con agua estéril, éstas se
dispusieron regularmente en placas de Petri de 150 mm con medio sólido GM estéril
(véase el apartado III.4.1.1.2). Las semillas se estratificaron a 4ºC durante 24 h y se
trasladaron a incubadores Sanyo MLR-350H, en unas condiciones de 18, 20 ó 25±1ºC,
60-70% de humedad relativa y con iluminación continua de 7.000 lux (tubos
fluorescentes Toshiba FL40SS·W/37). Después de un periodo de entre 15 y 22 días,
las plantas se trasplantaron a macetas o bandejas completando su ciclo de vida en la
cámara climática.
III.5.1.2.- Cultivos en maceta.
Se utilizaron bandejas de plástico de 28 x 50 cm con 42 alvéolos de 5 x 5 cm
(altura x diámetro) y con un orificio en la parte inferior, o macetas cuadradas de 12 x
12 x 5 cm con pequeños orificios, dispuestas en el interior de cubetas de plástico. En
los alvéolos se colocaron cestillos de plástico con rejilla rellenos de la mezcla de
sustrato (véase el apartado III.4.2.9). En las macetas cuadradas, el sustrato se dispuso
directamente en su interior. Como solución nutritiva se utilizó ATM (véase el apartado
III.4.1.1.1) mediante subirrigación.
A cada cestillo se trasplantó una sola planta procedente de las placas de
Petri. En el caso de las macetas, se trasplantaron entre 25 y 40 plantas por maceta.
En ocasiones, se sembraron semillas directamente sobre el sustrato. En ambos casos,
se taparon las cubetas con plástico transparente de uso alimentario agujereado en
varios puntos, con el fin de evitar la vitrificación de las plantas por un exceso de
humedad. El plástico se eliminó a los 3 días de incubación en la cámara climática o
bien a los 12 días tras la siembra directa en el sustrato. En el caso de la siembra en
Materiales y Métodos 51
cestillo, tras eliminar el plástico se colocaron soportes y cilindros de plástico del
sistema aracon (Arabidopsis condom, Beta Tech, Bélgica), que separan unos
individuos de otros. En el caso de la siembra directa en maceta, las semillas fueron
estratificadas a 4ºC durante las 48 h iniciales.
Las plantas se mantuvieron en la cámara climática a una temperatura de
20ºC±1ºC, 60-70% de humedad relativa y 7.000 lux de iluminación continua generada
por tubos fluorescentes Philips F72T12/D/VHO 160 W 1.500 SF (luz blanca fría), y
bombillas incandescentes de filamento de tungsteno de 60 W (luz roja). Durante las
dos primeras semanas de crecimiento en la cámara climática, se regaron las plantas
con solución nutritiva ATM, y posteriormente con agua potable de la red.
III.5.1.3.- Realización de cruzamientos.
En la realización de los cruzamientos entre distintas estirpes de Arabidopsis,
inmediatamente antes del estadio de antesis, a las flores de las plantas que actuaron
como parental femenino se les retiraron sépalos, pétalos y estambres con ayuda de
pinzas de cirugía y una lupa de 2,5 aumentos con iluminación, o bien una lupa
binocular (Leica Zoom 2000). Posteriormente, se pusieron en contacto las anteras
maduras del donante de polen (parental masculino) con el pistilo de la planta
receptora. Las semillas resultantes se almacenaron a 4ºC.
III.5.2.- Condiciones y métodos de cultivo para Escherichia coli y Agrobacterium
tumefaciens.
Los cultivos se efectuaron a 28ºC en el caso de Agrobacterium tumefaciens, o
a 37ºC para Escherichia coli, y se mantuvieron en agitación continua (Escherichia coli
a 225 rpm; Agrobacterium tumefaciens a 270 rpm) en un incubador con agitación
orbital Sanyo MIR222-RL. Para la realización de microcultivos (de 200 µl a 1 ml de
cultivo), se utilizó un agitador para tubos eppendorf con control de temperatura
(Thermomixer Compact, Eppendorf, Alemania). El cultivo en presencia de antibióticos
se realizó con las concentraciones reflejadas en la Tabla III.3.
Para la conservación de las estirpes bacterianas, a 1 ml de cultivo en medio
líquido con LB (y el correspondiente antibiótico, en caso de ser necesario) se le
añadieron 500 µl de glicerol al 80% (v/v) y se almacenó a –80ºC.
Materiales y Métodos 52
III.6.- Estudio de las características morfológicas e histológicas.
En este apartado se describen las técnicas utilizadas en la realización de los
estudios fenotípicos, tanto macro como microscópicos, de las plantas de Arabidopsis
analizadas.
III.6.1.- Fotografía a bajo aumento.
Para obtener imágenes a bajo aumento de los distintos rasgos fenotípicos se
han utilizado las cámaras digitales Mavica FD-877 (Sony) y CoolPix 5400 (Nikon).
En los exámenes preliminares de las características fenotípicas, se utilizó una
lupa binocular Leica Zoom 2.000. Para los análisis pormenorizados de las
características fenotípicas de particular interés, nos servimos de las lupas binoculares
Nikon SMZ 800 y Nikon SMZ 1500, provistas de una unidad de iluminación externa de
luz blanca fría (Volpi Intralux 5000-1) y conectadas a una cámara digital DXM1200F
(Nikon) para la captura de imágenes.
III.6.2.- Microscopia óptica.
III.6.2.1.- Inclusión en resina JB4.
Para la inclusión en resina se ha utilizado el sistema denominado JB4
(Polyscience), compuesto de tres elementos: A, la resina; B, un agente polimerizador,
y C, el catalizador. La resina es miscible en agua, lo que permite el procesado
completo de la muestra sin su total deshidratación.
Las muestras se trataron con el fijador FAA/Tritón-X100 (ácido acético glacial
5%, formalina 1,75%, etanol 50%, Tritón-X100 1%) y se sometieron a vacío (500 mb,
45 min). Se reemplazó el fijador por otro recién preparado y se dejó a temperatura
ambiente durante 1 h. Para la deshidratación, se eliminó el fijador y se trató
inicialmente con etanol 70% durante toda la noche a 4ºC. Se prosiguió la
deshidratación sometiendo las muestras a series de 2 h en etanol en concentraciones
crecientes (80%, 90% y 95%). Para poder visualizar la muestra, se añadió safranina
(0,5% m/v, Sigma-Aldrich) al etanol 95%, dejando de nuevo a 4ºC durante toda la
noche. Al día siguiente, para eliminar la sobretinción, se lavaron las muestras con
etanol 95% durante 2 h a temperatura ambiente.
Con posterioridad, se preparó la solución de la resina activa, disolviendo 1,25 g
del catalizador C (peróxido de benzoilo, Polyscience) en 100 ml de la solución de la
resina (A), con agitación. A continuación, se elaboró una mezcla 1:1 de etanol 95% y
solución de resina, añadiéndola a las muestras tras eliminar el etanol 95%. Se incubó
a temperatura ambiente durante 3 h, se sustituyó esta mezcla por solución de resina
Materiales y Métodos 53
activa y se mantuvo de nuevo a temperatura ambiente durante 3 h adicionales. Se
mezclaron 25 ml de resina activa con 1 ml de solución de polimerización (B) en un
tubo falcon de 50 ml, y se añadió a los moldes (molding cup tray, Polyscience) en los
que se encontraba la muestra tras ser incubada con la resina activa. Los moldes se
incubaron, envueltos en plástico transparente de uso alimentario, a 55ºC en un horno
de hibridación, favoreciendo así la polimerización, y se pegaron, en la orientación
adecuada, a cilindros de aluminio con un adhesivo instantáneo (Loctite, Henkel). Las
secciones histológicas de 3-4 µm obtenidas en el microtomo (2050 Supercut, ReichertJung, Cambridge Instruments Gmbh) se tiñeron con azul de toluidina (Sigma-Aldrich)
al 1% y ácido bórico al 0,6%.
Para la visualización, se utilizó un microscopio Nikon Eclipse E-800,
realizando el montaje con una gota de Eukitt (O.Kindler GMBH & Co.). Las imágenes
correspondientes se obtuvieron con una cámara digital COLORVIEW-III (Nikon)
acoplada al microscopio.
III.6.2.2.- Inclusión en parafina.
Tras la fijación inicial de las muestras, mediante tratamiento con vacío a 100
mb durante 10 min en la solución de fijación (etanol 50%, ácido acético glacial 5%,
formaldehído 3,7%), se reemplazó la solución por otra recién preparada y se incubó a
temperatura ambiente durante 2 h. Se deshidrataron las muestras (etanol 70%, 30
min; etanol 95%, 30 min) y se efectuó la tinción con Eosina Y 0,2% (m/v, SigmaAldrich) en etanol 95% durante 2 h a temperatura ambiente, y a continuación toda la
noche a 4ºC. La aclaración o diafanización del tejido (imbibición del tejido en una
sustancia miscible en parafina para facilitar su inclusión), se llevó a cabo con
Histoclear (National Diagnostics) que, esencialmente, se compone de limoneno.
Durante la diafanización se incubaron a temperatura ambiente las muestras en las
siguientes soluciones durante 2 h:
1)
Etanol 100% de gran pureza (dos incubaciones sucesivas).
2)
Histoclear 25% y etanol 75%.
3)
Histoclear 50% y etanol 50%.
4)
Histoclear 75% y etanol 25%.
5)
Histoclear 100% (dos incubaciones sucesivas).
Una vez realizados estos pasos, se vaciaron a la mitad los recipientes con las
muestras y se añadió parafina Paraplast-Plus (Sherwood Medical) fundida a 58ºC,
dejando las muestras toda la noche a dicha temperatura. Al día siguiente, se realizaron
varios cambios de parafina para permitir su penetración en el tejido y la eliminación del
Histoclear.
Materiales y Métodos 54
Se confeccionaron bloques de parafina con las muestras. En una placa
calefactora (Plactronic, Selecta) a 55ºC, se realizó el montaje empleando moldes
metálicos con una zona cóncava (Selecta) rellena de parafina fundida, en la que se
depositaron las muestras en la orientación deseada. Tras enfriarse la parafina, se
desmontaron los bloques. Se efectuaron cortes de 8 µm en el microtomo y las
secciones se dispusieron en un baño con agua desionizada estéril a 42ºC antes de
colocarlas en los portaobjetos. Las secciones se desparafinaron con Histoclear y se
montaron añadiendo una gota de Eukitt. Para la visualización, se utilizó el microscopio
Nikon Eclipse E-800 con iluminación de campo claro, con una cámara digital acoplada
COLORVIEW-III (Nikon) para la obtención de imágenes.
III.6.3.- Microscopía electrónica de barrido (SEM).
Las muestras se trataron con la solución fijadora FAA/Tritón X-100,
sometiéndolas a vacío (90 min, 500 mb). Se sustituyó el fijador por otro fresco,
incubando a temperatura ambiente durante 1 h. Tras decantar el fijador, se incubó en
etanol 70% toda la noche a 4ºC. Las muestras se deshidrataron en series crecientes
de etanol (80%, 90%, 95% y 100%) durante 2 h en cada una. Tras la deshidratación,
se realizó el punto crítico (critical point drying), consistente en la desecación completa
de la muestra mediante la sustitución del etanol por CO2 con un aparato EM5850
(Electron Microscopy Sciences). Para la colocación de las muestras en los pedestales
metálicos, se utilizó cinta de carbono adhesiva por ambas caras (Electron Microscopy
Sciences). Posteriormente, las muestras se recubrieron con oro utilizando un
recubridor Sputter Coater SCDOO4 (Balzers). Las muestras se observaron y se
fotografiaron en un microscopio electrónico de barrido JEOL modelo JSM-840
conectado a un ordenador para el almacenamiento de la captura de las imágenes.
III.7.- Aislamiento y manipulación de ácidos nucleicos.
III.7.1.- Preparaciones de DNA genómico de Arabidopsis thaliana.
Hemos seguido el método de obtención de DNA genómico de Arabidopsis
desarrollado por Dean y colaboradores (1992) y modificado por Li y colaboradores
(1999). El material vegetal se congeló con nitrógeno líquido y se homogeneizó en
presencia de tampón de extracción (véase el apartado III.4.2.2). Se incubó durante 10
min
a
37ºC
y
225
rpm.
A
continuación,
se
añadió
1/2
volumen
de
fenol:cloroformo:alcohol isoamílico (24:25:1) y, de nuevo, se incubó 10 min a 37ºC y
Materiales y Métodos 55
225 rpm, tras lo cual se centrifugó durante 10 min a 13.000 rpm. A la fase acuosa se le
añadió aproximadamente un volumen de isopropanol y 1/10 de volumen de NaOAc
3M. Tras precipitar unos minutos en hielo, se centrifugó la muestra durante 15 min a
13.000 rpm. El precipitado se lavó con etanol absoluto y se resuspendió en 40 µl de
agua estéril. A continuación, se dializaron las muestras durante 15 min utilizando un
filtro de nitrocelulosa (Millipore) de 0,025 µm de diámetro de poro dispuesto en la
superficie de un volumen de unos 50 ml de agua desionizada y estéril, sobre el que se
depositaron las muestras. Tras la diálisis se cuantificó el DNA en un espectrofotómetro
Biophotometer (Eppendorf, Alemania), midiendo una dilución 1:50 de cada
preparación.
III.7.2.- Preparaciones de DNA plasmídico.
Para la obtención de preparaciones a pequeña escala (minipreps) de DNA
plasmídico de pequeño tamaño, se partió de cultivos bacterianos de 3-10 ml de medio
líquido LB. Empleamos el kit Concert Rapid Plasmid Miniprep System (Gibco BRL),
basado en el método clásico de la lisis alcalina, siguiendo las instrucciones del
fabricante. Se verificó el rendimiento de la extracción mediante electroforesis en un gel
de agarosa al 1% teñido con bromuro de etidio.
En los aislamientos de DNA plásmídico a mayor escala y en la obtención de
PAC de estirpes de Escherichia coli, se empleó el método de lisis alcalina, realizando
la precipitación con polietilénglicol y NaCl de acuerdo con Sambrook y Russell (2001).
Finalmente, se resuspendió el precipitado en 200 µl de TE pH 7,6 o en agua. La
integridad de los PAC se verificó mediante electroforesis en gel de agarosa al 0,8%.
Las preparaciones obtenidas se almacenaron a –20ºC.
III.7.3.- Tratamiento de DNA con enzimas de restricción.
Se procuró utilizar una relación de 2 U de enzima por cada microgramo de DNA
a digerir, durante un tiempo que varió de 2 h a toda la noche. Las enzimas se
inactivaron por incubación a 70ºC durante 15 min y se verificó el resultado de la
digestión mediante electroforesis en gel de agarosa.
III.7.4.- Reacciones de ligación de DNA.
Las reacciones se llevaron a cabo en un volumen de 10 a 15 µl usando de 1 a
2,5 U de enzima ligasa del bacteriófago T4 (Fermentas). En los ensayos de clonación
Materiales y Métodos 56
de un inserto en un plásmido se utilizó un relación molar vector:inserto de entre 1:3 a
1:6. Los tubos de reacción se incubaron durante toda la noche a 16ºC.
III.7.5.- Técnicas electroforéticas.
III.7.5.1.- Electroforesis en geles de poliacrilamida (PAGE) en condiciones
desnaturalizantes.
Este tipo de electroforesis se utilizó en el análisis de las reacciones de
transcripción in vitro para la obtención de ribosondas. Se emplearon geles del 6% de
acrilamida (Pronadisa; acrilamida:bisacrilamida, 29:1) en presencia de 0,5X TBE y
urea 8 M. Las bandas de los ácidos nucleicos se observaron mediante tinción
convencional con bromuro de etidio e iluminación con luz ultravioleta (312 nm). Para la
obtención de fotografías, se utilizó una lámpara ultravioleta acoplada a un
documentador de geles GeneDOC con cámara digital (Vilmer Lourmat).
III.7.5.2.-
Electroforesis
en
geles
de
agarosa
en
condiciones
no
desnaturalizantes.
Se prepararon geles con agarosa de punto medio de electroendósmosis
(Ecogen) y un rango de concentración comprendido entre 0,8% y 2,5% (m/v),
empleando como electrolito 1X TAE. Los geles contenían bromuro de etidio (0,5
µg/ml), lo que permitió la visualización inmediata de los ácidos nucleicos tras
iluminación con luz ultravioleta. La obtención de fotografías se realizó de igual forma a
la comentada en el apartado anterior.
III.7.6.- Recuperación de DNA a partir de geles de agarosa.
Para este fin se siguió un procedimiento basado en la fusión de la agarosa,
cromatografía en una matriz de sílice y posterior elución siguiendo las instrucciones
proporcionadas por el fabricante (GENE-CLEAN, BIO-101). El éxito del procedimiento
se verificó mediante electroforesis en gel de agarosa (véase el apartado III.7.5.2).
III.7.7.- Amplificación de DNA mediante la reacción en cadena de la polimerasa
(PCR).
Las amplificaciones mediante PCR (Mullis et al., 1986) se llevaron a cabo
partiendo de una cantidad de DNA molde comprendida entre 5 ng y 40 ng, en
presencia de 0,3 µM de cada uno de los oligonucleótidos y 0,8 mM de una mezcla
equimolar de los cuatro desoxirribonucleósidos trifosfato (dNTP; 0,2 mM de cada uno
de ellos). Se añadió 0,05 U/µl de reacción de la polimerasa Taq (EcoGen). En aquellas
Materiales y Métodos 57
situaciones en las que se requería una elevada fidelidad de copia se utilizó una mezcla
de polimerasas con actividad correctora de prueba (High Fidelity, Roche Diagnostics).
En cada uno de los casos se siguieron las condiciones indicadas por el proveedor. Se
usaron tubos eppendorf de pared fina (0,2 ml y 0,5 ml). Los perfiles de reacción se
programaron en termocicladores Eppendorf Mastercycler y Eppendorf Mastercycler
Personal.
Las muestras se sometieron a 2 min de desnaturalización inicial a 93-95ºC,
20-35 ciclos de 20-45 s de desnaturalización a 93-95ºC, 20-30 s de apareamiento de
los cebadores a 45-70ºC y un periodo de extensión a 72ºC de 20 s a varios minutos.
La temperatura de hibridación utilizada fue siempre 5-10ºC inferior a la temperatura de
fusión (Tm, melting temperature) resultante de aplicar la siguiente fórmula con cada
oligonucleótido empleado como cebador:
Tm = 69,3 + 0,41·[%(G + C) del cebador] – (650/L)
L= longitud del cebador en nucleótidos
En aquellos casos en los que se añadió una diana para endonucleasa de
restricción en el extremo 5’ del cebador, la secuencia correspondiente no computó en
el cálculo de la Tm. Las reacciones se visualizaron mediante electroforesis en geles de
agarosa o poliacrilamida no desnaturalizantes.
III.7.8.- Secuenciación de DNA.
Las reacciones de secuenciación se efectuaron en un termociclador Eppendorf
MasterCycler aplicando las condiciones propuestas en el kit ABI PRISM BigDye
Terminator Cycle Sequencing v2.0 Ready Reaction (Perkin Elmer). Las electroforesis
de los productos de reacción se realizaron en un secuenciador automático ABI PRISM
377 (Perkin Elmer).
III.7.9.- Análisis y tratamiento informático de las secuencias de ácidos nucleicos
y proteínas.
El análisis de las secuencias de ácidos nucleicos y proteínas se realizó, de
forma interactiva a través de Internet, en los distintos bancos de datos internacionales
utilizando los programas BLAST (Altschul et al., 1997; Tatusova y Madden, 1999) de
las siguientes direcciones http://www.ebi,ac.uk/blast2/index.html (EBI, European
Bioinformatic Institute del European Molecular Biology Laboratory, EMBL; RodríguezTome, 2001), http://www.arabidopsis.org/wublast/index2.jsp (TAIR, The Arabidopis
Resource)
y
http://www.ncbi.nlm.nih.gov/BLAST/
(NCBI,
National
Center
for
Materiales y Métodos 58
Biotechnology Information, Benson et al., 2002). También se usó el programa FASTA
(Pearson, 1994) a través de la dirección http://www.ebi.ac.uk/fasta/index.html (EBI).
Para los alineamientos de secuencia se utilizó el programa CLUSTALW (Thompson et
al., 1994; Higgins et al., 1996) a través del servidor del EMBL. Para el alineamiento de
las secuencias de aminoácidos se utilizó el programa CLUSTALX 1.5b (Thompson et
al., 1997).
El análisis de los posibles dominios proteicos se realizó a través de la
dirección http://www.sanger.ac.uk/Software/Pfam/, donde se encuentra alojada la base
de datos Pfam (Bateman et al., 2004).
III.8.- Técnicas de hibridación molecular de ácidos nucleicos.
III.8.1.- Identificación de clones bacterianos mediante hibridación en colonia.
III.8.1.1.- Obtención de la sonda marcada.
En todos los casos se utilizaron sondas de DNA generadas por PCR. Como
molécula trazadora se utilizó la digoxigenina en forma de digoxigenina-11-dUTP
presente en la mezcla de desoxinucleósidos trifosfato (7 TTP:1 DIG 11-UTP). Una vez
comprobada la reacción, el producto de la amplificación se precipitó en presencia de
etanol y cloruro de litio 0,4 M, y una vez centrifugado, se resuspendió en el volumen
deseado.
III.8.1.2.- Transferencia del DNA a una membrana de nailon.
Las colonias a estudiar se repicaron de forma uniforme en placas de Petri de
90 mm, utilizando una plantilla patrón a fin de colocar al menos 60 clones por placa, y
se dejaron crecer durante 12 h. Tras poner en contacto la superficie de la placa con
una membrana de nailon (Hybond-N, Amersham Biosciences), ésta quedó impregnada
con las colonias. Las membranas se incubaron 5 min. sobre varias capas de papel
GB002 (Schleicher & Schuell), equivalente al 3MM, saturadas en solución de
desnaturalización (véase el apartado III.4.2.5) durante 5 min. A continuación, otros 5
min en varias capas saturadas en solución de neutralización; y, por último, 5 min
adicionales en capas de papel saturadas en 20X SSC. Posteriormente, se inmovilizó el
DNA mediante irradiación con luz UV (crosslinker, UniEquip Research, 120mJ/cm2) y
se eliminaron los residuos bacterianos incubando la membrana en una solución 2X
SSC y 0,1% de SDS a temperatura ambiente.
Materiales y Métodos 59
III.8.1.3.- Tratamientos de prehibridación, hibridación con la sonda y lavado de la
membrana.
La prehibridación tuvo lugar con la membrana sumergida en solución de
prehibridación (véase el apartado III.4.2.5) durante 2 h a 65ºC. Para la hibridación, se
sustituyó la solución de prehibridación por otro volumen de la misma conteniendo la
sonda, previamente desnaturalizada por calentamiento a 90ºC durante 10 min. La
concentración de sonda fue de 40 ng/ml. La hibridación tuvo lugar durante 12 h a
65ºC.
Tras la hibridación, para eliminar el exceso de sonda, la membrana se lavó dos
veces con 2X SSC y 0,1% SDS a temperatura ambiente, seguidas de otros dos
lavados con una solución 0,1X SSC y 0,1% SDS a 65ºC.
III.8.1.4.- Detección colorimétrica de la señal.
La fosfatasa alcalina, conjugada al anticuerpo anti-DIG, es capaz de
desfosforilar al compuesto 5-bromo-4-cloro-3-indolil fosfato de toluidino, que se
comercializa con el nombre de BCIP (Roche Diagnostics) y que, en presencia de NBT
(cloruro de azul nitro-tetrazoilo, Roche Diagnostics), da lugar a la formación de un
precipitado de color ocre fácilmente visible. Para la detección, se siguieron los pasos
que a continuación se detallan:
1)
Equilibrado de la membrana con tampón maleico (véase el apartado III.4.2.5)
durante 5 min.
2)
Tratamiento de la membrana con la solución bloqueante (véase el apartado
III.4.2.5) durante 1 h.
3)
Incubación de la membrana con una dilución 1:5000 (150 mU/ml) del
anticuerpo en tampón maleico durante 45 min.
4)
Tres lavados de 20 min con tampón maleico para eliminar el exceso de
anticuerpo.
5)
Equilibrado de la membrana con el tampón para detección colorimétrica (véase
el apartado III.4.2.5) durante 5 min, e incubación con esta misma solución y el
sustrato (0,375 ng/ml de NBT y 0,19 ng/ml de BCIP) durante 1 h en oscuridad.
La aparición de manchas de color ocre indica la posición de los clones
positivos.
Materiales y Métodos 60
III.8.2.- Análisis de la expresión mediante hibridación in situ en tejidos vegetales.
III.8.2.1.- Obtención de ribosondas marcadas con digoxigenina.
El plásmido pGEM-T posee los promotores para las polimerasas de RNA de los
bacteriófagos SP6 y T7, por lo que se usó como molde de transcripción in vitro tras
clonar en él el inserto deseado. Se linearizaron 5 µg del plásmido recombinante con la
enzima apropiada, se precipitaron con acetato sódico 3,2 M pH 5,2 y etanol, y se
resuspendieron en agua. Se usaron 2 µg de plásmido cortado como molde para una
reacción de 20 µl en presencia de digoxigenina-11-dUTP de la mezcla DIG-RNA
labelling mix (Roche Diagnostics), 1 µl (40 U) de inhibidor de RNasas, 2 µl de la
polimerasa de RNA (T7 o SP6 10U/µl, Roche Diagnostics) y 2 µl del tampón 10X de la
enzima correspondiente (Roche Diagnostics). La reacción tuvo lugar a 37ºC durante
90 min. Paralelamente, se realizaron reacciones control en las mismas condiciones
pero sin digoxigenina.
Tras la incubación, se añadió 1 µl de DNasaI libre de RNasas (10 U/µl, Roche
Diagnostics) a la mezcla de reacción, y se mantuvo 15 min a 37ºC. Se analizó una
alícuota mediante electroforesis en un gel desnaturalizante de poliacrilamida (PAGE,
6%, véase el apartado III.7.5.1). Se precipitó la sonda con tRNA de levadura (1 µg/µl,
Roche Diagnostics), acetato amónico 0,6 M y 220 µl de etanol absoluto, y se almacenó
a –20ºC hasta el momento de cuantificar el rendimiento del marcaje de la sonda.
III.8.2.2.- Cuantificación del rendimiento del marcaje.
Se centrifugó la sonda a 4ºC y 13.000 rpm durante 15 min, se eliminó el
sobrenadante, se lavó el precipitado con etanol 70%, se dejó secar al aire y se
resuspendió en 10 µl de agua tratada con DEPC. Con 1 µl de esta disolución se
prepararon las diluciones a emplear en la cuantificación: 1/20, 1/250, 1/1000 y 1/2500.
De cada una de las diluciones anteriores se aplicó 1 µl a una membrana de nailon (dot
blot) que, tras secarse, se irradió con luz UV. El revelado de esta membrana se realizó
junto con una tira control con distintas concentraciones de RNA marcado con
digoxigenina (RNA scripts Test, Roche Diagnostics), lo que permitió la determinación
empírica de la concentración de sonda a utilizar en cada caso.
Materiales y Métodos 61
III.8.2.3.- Obtención y procesamiento histológico de las muestras.
Se fijaron muestras de tallos tomadas a 1 cm del meristemo, donde se están
formando los haces vasculares, y en la parte media de tallos de inflorescencia, con el
fin de observar entrenudos que han dejado de elongarse. Los procedimientos
histológicos para la inclusión en parafina se detallan en el apartado III.6.2.2, con la
salvedad para la hibridación in situ de que, en lugar de portaobjetos convencionales,
se emplearon portaobjetos Probe-On-Plus (Fisher), tratados en origen de forma que el
tejido queda fuertemente adherido. Los moldes de parafina con las muestras se
almacenaron a 4ºC hasta su utilización.
III.8.2.4.- Prehibridación e hibridación de la sonda.
En esta etapa tiene lugar el acceso de la ribosonda al interior celular.
Previamente, se ha procedido a la desparafinización de las muestras, hidratación y
permeabilización parcial de la membrana y la pared celular.
Se desparafinó el tejido con dos tratamientos sucesivos con Histoclear (10 min
cada uno). Se rehidrataron los tejidos con series decrecientes de etanol de 2 min cada
una: dos veces en etanol absoluto, una vez en etanol 95%, 70%, 50%, 30%, y dos en
agua. En este punto, se realizó la hidrólisis ácida del tejido con HCl 0,2 N durante 20
min a temperatura ambiente. Se prosiguió con un lavado de 5 min con agua, 5 min en
2X SSC y nuevamente 5 min con agua. A continuación, se incubaron los portaobjetos
con el tejido en presencia de proteinasa K (1µg/µl) durante 15 min a 37ºC. Se lavaron
durante 2 min con 1X PBS y se bloqueó la acción de la proteinasa K incubando 2 min
en 1X PBS con glicina (0,2% m/v). Tras dos lavados con 1X PBS de 2 min cada uno,
se volvió a fijar el tejido con una solución de 1X PBS y formaldehído (3,7% v/v) a
temperatura ambiente durante 10 min, seguido de dos pasos de 5 min con 1X PBS. Se
prosiguió con la deshidratación del tejido en series crecientes de etanol de 2 min cada
paso hasta llegar al etanol absoluto. Tras secar brevemente los portaobjetos, se
sometieron a vacío durante 20 min a una presión de 100 mb.
Para la hibridación, se precalentaron los portaobjetos con el tejido en una placa
calefactora (Selecta) a 45ºC durante unos minutos. Mientras tanto, se prepararon las
diluciones de la sonda en tampón de hibridación, desnaturalizando a 80ºC. Se
aplicaron 300 µl de la solución de hibridación a cada portaobjetos con su muestra
correspondiente, disponiéndose éstos enfrentados dos a dos. Gracias al sistema
Probe-On-Plus, entre los tejidos de ambos portaobjetos se genera un espacio donde
Materiales y Métodos 62
discurre la solución de hibridación en contacto con el tejido. Para la hibridación, los
portaobjetos emparejados se guardaron en una cámara húmeda toda la noche a 52ºC.
III.8.2.5.- Lavados e inmunodetección colorimétrica de la señal.
Tras realizar dos lavados de 90 min en una solución 2X SSC y formamida (50%
v/v), se desarrolló la inmunodetección. Los portaobjetos se incubaron sucesivamente
en 1X TBS durante 5 min; 1 h con solución bloqueante con 1X TBS, y 30 min en 1X
TBS, Tritón X-100 (0,3% v/v) y BSA (1% m/v). A continuación, se incubaron 90 min
con el anticuerpo anti-DIG (dilución 1:3.000) en esta última solución. Se realizaron tres
lavados de 20 min cada uno con la misma solución sin anticuerpo, con el fin de
eliminar su exceso. Para alcalinizar el medio, incubamos con el tampón de detección
sin sustrato durante 5-10 min (III.4.2.6). Esta solución se reemplazó por el tampón de
detección con el sustrato. Por cada 100 ml de solución de detección, se añadieron 150
µl de NBT (III.8.1.4, 100 mg/ml) y 150 µl de BCIP (III.8.1.4, 50 mg/ml). Se incubó en
oscuridad durante un periodo que osciló entre 12 y 18 h. La reacción se detuvo
reemplazando la solución de detección por agua.
En el montaje de los portaobjetos, se deshidrató el tejido en series crecientes
de etanol de forma rápida (2 min cada una), tras lo cual se añadió una gota de Eukitt al
portaobjetos y se dispuso el cubreobjetos. Las muestras se visualizaron utilizando un
microscopio Eclipse E-800 de Nikon con cámara digital COLORVIEW-III (Nikon)
conectada a un ordenador con el sistema de análisis de imágenes AnalySiS (Nikon).
III.9.- Transformación bacteriana.
III.9.1.- Transformación por choque térmico.
Para la obtención de células competentes, partimos de la estirpe DH5α de E.
coli y se siguió el protocolo descrito en Sambrook y Russell (2001). Las cantidades de
DNA empleadas para transformar oscilaron entre 1 y 10 ng.
III.9.2.- Transformación por electroporación.
Se utilizó esta técnica en aquellos casos en los que se requería un elevado
número de transformantes de E. coli, o en el caso de Agrobacterium tumefaciens,
donde fue el método rutinario de transferencia. Las cepas bacterianas utilizadas con
este procedimiento fueron DH10β (E. coli), y LBA4404 y C58C51 (Agrobacterium
Materiales y Métodos 63
tumefaciens). Las muestras de DNA se dializaron con membranas de nitrocelulosa de
0,025 µm de diámetro de poro durante 15 min. Se utilizaron cubetas Eppendorf de 2
mm de paso y se empleó un electroporador modelo Electroporator 2510 (Eppendorf,
Alemania) con los siguientes parámetros: 2.500 V de descarga, 10 µF y 330 Ω de
resistividad.
III.10.- Transformación de Arabidopsis thaliana.
Hemos transformado plantas con estirpes de Agrobacterium tumefaciens
portadoras de T-DNA modificados como vehículo de introducción de construcciones
exógenas.
III.10.1.- Obtención de las construcciones de sobreexpresión.
El cDNA completo del gen At1g52150 de Arabidopsis thaliana se obtuvo a
partir de la colección de clones de cDNA de Arabidopsis thaliana generada en el
Instituto RIKEN Genomics Sciences Center (clon RAFL09-35-K18; Seki et al., 1998;
2002). Se amplificó mediante PCR con la mezcla de polimerasas High Fidelity (Roche
Diagnostics) utilizando los cebadores F5F19.21-14 y F5F19-15 (véase la tabla III.2).
El cDNA mutante se ha generado mediante la mutagénesis in vitro del cDNA
silvestre tras la amplificación por PCR a partir del clon RAFL09-35-K18 con dos
parejas de cebadores: la pareja F5F19.21-16 y F5F19-15, y la pareja F5F19.21-17 y
F5F19.21-14 (véase la tabla III.2). Los cebadores F5F19.21-16 y F5F19.21-17 se han
diseñado para crear una transición G→A en la quinta posición del quinto exón del gen
At1g52150. El cDNA mutante se obtuvo amplificando con los cebadores F5F19.21-14
y F5F19.21-15, utilizando los fragmentos generados con las dos parejas anteriores
como molde.
Tanto el cDNA silvestre como el mutante, se digirieron con las enzimas SalI y
BamHI, presentes en los cebadores F5F19.21-14 y F5F19-15, respectivamente, para
su clonación en el plásmido pBINJIT (véase el apartado III.2) en la orientación
adecuada para su expresión (Fig. III.2). Estas construcciones, denominadas 35S:ICU4
y 35S:ICU4-G189D, respectivamente, se introdujeron en la estirpe C58C1 de
Agrobacterium tumefaciens (véase el apartado III.1.3) mediante electroporación (véase
el apartado III.9.2).
Materiales y Métodos 64
III.10.2.- Obtención de la construcción de interferencia.
Para la obtención de la construcción 35S:ICU4-RNAi, se amplificó una porción
genómica de la región codificante del gen At1g52150 con las dos parejas de
cebadores idénticas F5F19.21-10 y F5F19.21-11, y F5F19.21-12 y F5F19.21-13, pero
que contienen dianas para las enzimas de restricción SalI y BamHI, y XhoI y BglII,
respectivamente (véase la tabla III.2). Ambos fragmentos se clonaron en el vector
pCF6 (véase el apartado III.2) en orientaciones opuestas, quedando separados por el
sexto intrón del gen FUL. Esta combinación se transfirió al plásmido pBIN-JIT (Fig.III.2)
y, posteriormente, se introdujo en la estirpe C58C1 de Agrobacterium tumefaciens
(véase el apartado III.1.3) mediante electroporación (véase el apartado III.9.2).
III.10.3.- Infiltración con Agrobacterium tumefaciens.
El presente protocolo está basado en el de Clough y Bent (1998) que es, a su
vez, una modificación simplificada del desarrollado por Bechtold (1993). Este
procedimiento no requiere la utilización de hormonas ni de vacío para llevar a cabo la
infiltración.
A una bolsa de sustrato esterilizada, se le añadió medio ATM hasta
humedecerlo completamente. El sustrato se dispuso en macetas cuadradas de 12 x 12
x 12 cm (largo x ancho x alto), que se envolvieron por completo con plástico
transparente de uso alimentario al que se le practicaron de 25 a 30 agujeros, donde se
trasladaron plántulas de 15 días previamente cultivadas en placas de Petri. Se
cultivaron las plantas hasta que se desarrollaron las inflorescencias y aparecieron las
primeras flores en antesis y algún fruto en desarrollo, los cuales se eliminaron
previamente a la infiltración.
Se prepararon cultivos de Agrobacterium tumefaciens de 10 ml con masilla
bacteriana del clon de interés, cultivado recientemente en placa de Petri, y se incubó a
28ºC y 270 rpm durante 24-48 h. Se tomó un 1 ml de este cultivo para la inoculación
de 500 ml de LB enriquecido con glucosa al 0,5% (m/v). Se incubó a 270 rpm y 28ºC
hasta llegar a una A600 de entre 0,8 y 1,2. En este momento, se centrífugo el cultivo a
7.500 rpm durante 15 min a 4ºC. El precipitado resultante se resuspendió en solución
de infiltración (III.4.2.7) hasta obtener una A600 de 0,8. A continuación, se añadió Silwet
L-77 (Lehle Seeds). Esta solución se dispuso en bandejas de 15 x 20 x 5 cm (largo x
ancho x alto) sumergiendo y agitando las inflorescencias de las plantas unos segundos
(floral dipping). Las plantas infiltradas se trasladaron a la cámara climática hasta
completar su ciclo y recoger las semillas.
Materiales y Métodos 65
G>A
A
B
SalI
BamHI
SalI
BamHI
C
Intrón 6 de
FUL
SalI
BamHI BglII
XhoI
F5F19.21-10
F5F19.21-11
F5F19.21-12
F5F19.21-13
F5F19.21-14
F5F19.21-15
F5F19.21-16
F5F19.21-17
Figura III.2.- Esquemas de las construcciones transgénicas. (A) Esquema de la construcción de
sobreexpresión del cDNA silvestre del gen ATHB15, a la que hemos denominado 35S:ICU4. (B)
Esquema de la construcción 35S: ICU4-G189D de sobreexpresión del cDNA del gen ATHB15 en el que
hemos generado la misma mutación presente en el alelo icu4-1, una transición G→A en la quinta posición
del quinto exón, mediante los cebadores F5F19.21-16 y F5F19.21-17. (C) Esquema de la construcción de
interferencia, 35S:ICU4-RNAi, que contiene una porción genómica de la región codificante del gen
ATHB15 (azul) clonada en orientaciones opuestas, quedando ambos fragmentos separados por el sexto
intrón del gen FUL. Las flechas negras indican el sentido de la transcripción.
Materiales y Métodos 66
III.10.4.- Selección de los transformantes.
Con el fin de identificar los individuos transformantes, las semillas resultantes
de las plantas infiltradas se sembraron de forma masiva en placas de Petri (1.0001.500 semillas por placa) que contenían medio de cultivo GM (véase el apartado
III.4.1.1.2) y kanamicina, el antibiótico al cual el T-DNA confería resistencia.
III.11.- Cartografía génica mediante análisis de ligamiento a marcadores SSLP.
La cartografía génica se realizó a partir de muestras de DNA genómico
correspondientes a individuos de la progenie F2 de cruzamientos entre el mutante y un
ecotipo distinto de su ancestro silvestre, que deben ser polimórficos para los
marcadores empleados.
Se obtuvo una población cartográfica integrada por 50 plantas F2, procedentes
del cruzamiento entre el mutante icu4-1 (ecotipo En-2) y el ecotipo silvestre Ler, que
manifestaban el fenotipo recesivo, en nuestro caso el fenotipo silvestre. Las plantas se
recolectaron 21 días después de la siembra para proceder a la extracción de su DNA
genómico (véase apartado III.7.1).
Se ha empleado el marcador molecular de tipo SSLP (Simple Sequence Lenght
Polymorphism) CER452458 (Cereon Genomics, Monsanto Company), situado en el
BAC F5F19 del cromosoma I, tras comprobar que se trata de un marcador que
muestra polimorfismo entre En-2 y Ler, de tal forma que con los oligonucleótidos
CER452458F y CER452458R (véase la tabla III.2) se obtiene un producto de
amplificación de 140 pb en el caso de En-2 y de 113 pb en el de Ler. Una vez
comprobado esto, procedimos al genotipado para este marcador de los 50 individuos
de la población cartográfica.
III.12.- Genotipado molecular de los alelos icu4.
Como consecuencia de las inserciones de T-DNA en los alelos icu4-4 e icu45, se generaron polimorfismos moleculares de tipo SSLP. Con el objetivo de poder
genotipar estos alelos, se diseñaron dos cebadores que flanquean el punto de
inserción, y otro situado en el borde izquierdo del T-DNA, de manera que en el alelo
silvestre y en el mutante se amplifican bandas de diferente tamaño (Tabla III.4).
Materiales y Métodos 67
Tabla III.4.- Genotipado molecular de los alelos icu4.
Alelo
icu4-4
icu4-5
Cebadores
genómicos
F5F19.21-R1;
F5F19.21-7
F5F19.21-22;
F5F19.21-24
Cebador en el
T-DNA
Tamaño de los
producto de
amplificación en pb
(silvestre/mutante)
SALKLBb1
2500/1000
SALKLBb1
610/720
III.13.- Tratamientos con auxinas y con inhibidores de su transporte.
Se prepararon disoluciones madre del inhibidor del transporte polar de
auxinas NPA (Naphthylphthalamic acid, Duchefa Biochemie) y de la auxina sintética
NAA (1-Naphtalene acetic acid, Duchefa Biochemie) de 400 mM y 10 mM,
respectivamente, en DMSO.
Se sembraron las semillas en medio sólido GM en las condiciones
anteriormente descritas (véase apartado III.5.1.1). Las plántulas fueron trasplantadas
12 días después de la siembra a macetas cuadradas y subirrigadas con medio ATM al
que se le había añadido 10, 20 ó 40 µM NPA, ó 0.1, 0.5 ó 1 µM NAA. Como control, se
subirrigaron plantas con ATM que contenía la misma cantidad de DMSO añadida junto
al NPA o el NAA.
III.14.- Análisis estadístico mediante χ2.
El valor de χ2 se obtuvo tras contrastar los datos obtenidos en las
segregaciones con las hipótesis de partida. No se rechazaron las hipótesis cuyo valor
de χ2 fue inferior al existente con un grado de significación del 95%. En la Tabla III.5 se
muestran los valores del estadístico para distintos grados de libertad, correspondiendo
éstos al número de clases fenotípicas menos uno.
Materiales y Métodos 68
Tabla III.5.- Valores del estadístico χ2 con distintos
grados de libertad (GL).
Grados de Libertad
χ20,95
1
2
3
3,84
5,99
7,82
IV.- Resultados
Resultados 70
IV.- Resultados
IV.1.- Caracterización fenotípica de los mutantes icu4-1 e icu4-2.
Con el fin de poder inferir la función del gen INCURVATA4 (ICU4) y la
naturaleza de las alteraciones ocasionadas por los alelos icu4-1 e icu4-2, se ha
realizado la caracterización fenotípica exhaustiva de los distintos órganos de los dos
mutantes. Ambos presentan exactamente el mismo fenotipo, observándose que éste
es sensible a la temperatura, ya que es más severo a 25ºC que a 20ºC o 18ºC (esta
Tesis; José Luis Micol, comunicación personal), y muy pleiotrópico, viéndose
afectados procesos tan diversos como el establecimiento del eje adaxial-abaxial en los
órganos laterales, la filotaxia, el tiempo de floración, el establecimiento del patrón
vascular y la embriogénesis.
IV.1.1.- Morfología foliar.
El rasgo fenotípico más conspicuo de los mutantes icu4-1 e icu4-2 se observa
en las hojas, cuyos márgenes están curvados hacia el haz, un fenotipo que ha recibido
la denominación de Incurvata (Serrano-Cartagena et al., 2000). El fenotipo resulta
evidente tanto en las hojas embrionarias, los cotiledones, como en las hojas de la
roseta basal y las caulinares, siendo más acusado en los primeros pares de hojas
postembrionarias (Fig. IV.1). La curvatura foliar es más fuerte en los homocigotos icu41/icu4-1 (Fig. IV.1 B, F) que en los heterocigotos ICU4/icu4-1 (Fig. IV.1 C, G), si bien
éstos también se distinguen claramente de las plantas silvestres En-2 (Fig. IV.1 A, E),
principalmente en las etapas iniciales de la expansión foliar.
Hay varias posibles interpretaciones que permiten explicar el comportamiento
semidominante de los alelos icu4-1 e icu4-2. La semidominancia podría deberse a la
haploinsuficiencia de una mutación de pérdida de función o, alternativamente, a una
mutación de ganancia de función. Una aproximación para distinguir entre estas dos
alternativas es la realización de un análisis de dosis del gen en triploides portadores de
una única dosis del alelo mutante y dos dosis del correspondiente alelo silvestre
(Timpte et al., 1994). Esta estrategia se llevó a cabo mediante el cruzamiento del
homocigoto icu4-1/icu4-1 con la línea tetraploide LC611, de fenotipo silvestre, lo que
permitió obtener una F1 triploide con dos copias del alelo silvestre y una copia del
mutante (genotipo ICU4/ICU4/icu4-1). El fenotipo de estas plantas (Fig. IV.1 D, H) es
similar al del heterocigoto ICU4/icu4-1, lo que sugiere que se trata de un alelo de
ganancia de función. De haberse tratado de un caso de haploinsuficiencia, se habría
esperado que las dos dosis del alelo silvestre presentes en el triploide hubieran sido
Resultados 71
suficientes para conferir un fenotipo normal. Así mismo, este resultado sugiere que el
alelo mutante tampoco es del tipo antimorfo o dominante negativo, ya que en tal caso
se habría esperado una cierta reducción del fenotipo mutante del triploide respecto al
del heterocigoto.
A
B
C
D
E
F
G
H
Figura IV.1.- Fenotipo de las rosetas basales y de las hojas vegetativas de plantas En-2 e icu4-1. Rosetas
y hojas del silvestre En-2 (A, E), del homocigoto icu4-1/icu4-1 (B, F), del heterocigoto ICU4/icu4-1 (C, G) y
del triploide ICU4/ICU4/icu4-1 (D, H). Las imágenes fueron tomadas 20 días después de la germinación.
En las ampliaciones (E-H), todas las hojas pertenecen al segundo nudo. Las barras de escala equivalen a
50 mm (A-D) y a 25 mm (E-H).
Se han obtenido cortes histológicos de cotiledones y de hojas juveniles
silvestres y mutantes, no observándose ninguna perturbación evidente en las
estructuras internas de los órganos mutantes que permita explicar la curvatura
observada (Fig. IV.2), tal y como se había descrito previamente para las hojas
(Serrano-Cartagena et al., 2000), salvo una ligera disminución del tamaño de las
células tanto de la epidermis adaxial como de la abaxial.
A
B
Figura IV.2.- Cortes transversales de cotiledones de plántulas de 3 días. Los cortes se realizaron
aproximadamente en la parte central del limbo de los cotiledones de En-2 (A) e icu4-1 (B). La barra de
escala equivale a 100 µm.
Resultados 72
No obstante, se observan alteraciones que afectan a la superficie abaxial de
las hojas vegetativas de los mutantes icu4-1 e icu4-2. Una de dichas alteraciones es la
ausencia de tricomas en la superficie abaxial de las hojas de la roseta basal, hasta la
quinta o sexta hoja. Por el contrario, hemos comprobado que en el ecotipo En-2, el
ancestro silvestre del mutante icu4-1, sólo las tres primeras hojas carecen de tricomas
en la superficie abaxial, al igual que sucede en los ecotipos Wassilewskija (Ws-2) y
Landsberg erecta (Ler; Telfer y Poethig, 1994; Telfer et al., 1997). Además,
ocasionalmente, los mutantes presentan crecimientos anómalos en esta superficie,
cerca del margen foliar (Fig. IV.3).
A
B
Figura IV.3.- Crecimientos anómalos en la superficie abaxial de hojas vegetativas del mutante icu4-1. Las
imágenes fueron obtenidas 20 días después de la germinación. Ambas hojas pertenecen al tercer nudo.
Las barras de escala equivalen a 50 mm.
IV.1.2.- Estructura corporal.
La filotaxia de las hojas de la roseta también está alterada en los mutantes
icu4-1 e icu4-2. Mientras que los individuos silvestres presentan para el primer y el
segundo par de hojas una filotaxia decusada, es decir, con un ángulo de divergencia
de 180º, y el resto se dispone según un patrón de filotaxia espiral con un ángulo de
divergencia que oscila alrededor de 137,5º (Kang et al., 2003; Fig. IV.1 A), las plantas
homocigotas mutantes mantienen la filotaxia decusada (ángulo de divergencia de
180°) hasta el cuarto o quinto par de hojas (Fig. IV.1 B). Así mismo, las inflorescencias
principales de los mutantes también muestran fallos en la filotaxia, observándose
ocasionalmente el desarrollo de dos hojas caulinares, con sus ramas axilares
asociadas, partiendo del mismo nudo o de dos nudos separados por un entrenudo
muy corto y siguiendo un patrón decusado (Fig. IV.4 A, B). Además, la longitud de los
entrenudos entre silicuas, un rasgo relativamente constante en los individuos
silvestres, presenta una mayor variabilidad en todas las inflorescencias de las plantas
mutantes (Fig. IV.4 C, D, E).
Resultados 73
B
A
D
C
E
35
5
30
0
25
5
20
0
15
5
10
0
5
5
0
0
En-2
icu4-1
<1
1-5
6-10
11-15
16-20
21-25
>26
Longitud de los entrenudos
Figura IV.4.- Alteración de la filotaxia de los mutantes icu4-1. (A) Plantas En-2 (izquierda) e icu4-1
(derecha), 50 días después de la siembra. En el mutante icu4-1 se aprecian dos hojas caulinares surgiendo
del mismo nudo o de dos nudos muy próximos y mostrando una filotaxia decusada (flecha). (B) Fallo en la
filotaxia en una planta icu4-1. La longitud de los entrenudos es bastante constante en el silvestre (C), lo
que no sucede en el mutante, en el que además se observa el reducido tamaño de las silicuas (D). La
barra de escala equivale a 1 cm. (E) En la gráfica se representa la longitud de los entrenudos (mm) entre
las 11 primeras silicuas de 10 plantas En-2 y de 10 plantas icu4-1.
Estas alteraciones en el patrón de filotaxia podrían deberse a una
malformación en la estructura del meristemo. No obstante, no parece ser esto lo que
ocurre en los homocigotos icu4-1 e icu4-2, ya que no se observa ninguna diferencia
apreciable, ni en el tamaño ni en la morfología, entre los cortes longitudinales de los
meristemos de plántulas En-2 e icu4-1, tres días después de la germinación (Fig. IV.5).
Resultados 74
B
A
Figura IV.5.- Meristemo apical del tallo de plántulas En-2 e icu4-1, 3 días después de la germinación. (A)
Sección longitudinal de una plántula En-2. (B) Sección longitudinal de una plántula icu4-1. Las barras de
escala equivalen a 50 µm.
Los mutantes icu4-1 e icu4-2 florecen más tarde que su ancestro silvestre En2 (Fig. IV.6). Para verificar esta observación con mayor precisión, se determinó el
tiempo de floración en las plantas mutantes icu4-1 y en las silvestres En-2 (día
después de la siembra en el que se observan las yemas florales). Los resultados
obtenidos, que se recogen en la Tabla IV.1, permiten afirmar que los mutantes icu4-1
son de floración tardía, lo que se traduce en que tardan más que el silvestre en sufrir la
transición floral y acumulan, por tanto, un mayor número de hojas en la roseta basal
(Fig. IV.6). Este último rasgo es un parámetro ampliamente aceptado para cuantificar
el tiempo de floración, ya que las plantas de floración tardía presentan un mayor
número de hojas vegetativas (Koornneef, 1991; 1995).
A
B
Figura IV.6.- Retraso en el tiempo de floración en los
mutantes icu4-1. Plantas En-2 (A) e icu4-1 (B) 45 días
después de la siembra. Esta última acaba de sufrir la
transición floral y presenta un mayor número de hojas en
la roseta basal. La barra de escala equivale a 1 cm.
Resultados 75
Tabla IV.1.- Tiempo de floración y número de hojas que forman la roseta en el silvestre (En-2) y
en las plantas mutantes icu4-1.
Tiempo de floracióna
Nº de hojas en la rosetab
En-2
24,9 ± 3,9
14,9 ± 2
icu4-1
39,3 ± 2,6
39 ± 7,7
Cada valor representa la media calculada a partir de los datos obtenidos de 25 plantas En-2 y
de 35 plantas icu4-1 ± desviación estándar.
a
Día después de la siembra, en el que las yemas florales son visibles.
b
Los datos son de plantas que han sufrido la transición floral. En-2 40 días después de la
siembra e icu4-1 50 días después de la siembra.
IV.1.3.- Morfología de los órganos florales.
Los órganos florales no están afectados en los mutantes icu4-1 e icu4-2, ni en
el número ni en la morfología. En las imágenes obtenidas mediante microscopía óptica
y de barrido, no se observa ninguna diferencia entre las plantas homocigotas mutantes
y las plantas En-2. Sin embargo, los frutos de los mutantes tienen un tamaño menor
que los del silvestre (Fig. IV.4 D). Este fenotipo se debe a una disminución en la
fertilidad del polen de las plantas mutantes, ya que la polinización de los pistilos de las
plantas icu4-1 e icu4-2 con polen silvestre da lugar a la recuperación de este fenotipo.
IV.1.4.- Morfología del patrón vascular en la inflorescencia.
Para comprobar si los mutantes tienen alterado el patrón vascular del tallo, se
realizaron cortes transversales en la parte media de la inflorescencia principal de
plantas silvestres de 55 días, y de plantas mutantes de 60 días, o de 75 días en el
caso de plantas con floración especialmente tardía. Las secciones de los tallos de los
individuos silvestres En-2 constan habitualmente de 7 a 9 haces vasculares,
separados por fibras interfasciculares, que se organizan formando una eustela (véase
el apartado I.6.3.1). En los haces vasculares, el xilema y el floema adoptan un patrón
colateral, es decir, con el xilema dispuesto hacia el interior del tallo y el floema hacia la
periferia, estando ambos separados por el procámbium (véase apartado I.6.3.1; Fig.
IV.7 A, C). Los haces vasculares en el mutante icu4-1 también adoptan un patrón
colateral (Fig. IV.7 B, D). Ocasionalmente, el número de éstos en los tallos mutantes
es menor que en los silvestres (Fig. IV.7 B, G), si bien el área media es mayor en el
caso de las secciones de los haces vasculares del mutante (Tabla IV.2; Fig. IV.7 B, D).
Resultados 76
Los haces del homocigoto icu4-1 contienen más capas de procámbium, y
como consecuencia, se observa una producción mucho mayor de floema y algo
incrementada en el caso del xilema, así como un mayor tamaño de las traqueidas del
metaxilema (Tabla IV.2; Fig. IV.7 B, D). Estas diferencias afectan también a la
morfología de los haces vasculares, de manera que las secciones de éstos en el
silvestre adoptan la forma de un triángulo isósceles, mientras que en el mutante suelen
aparecer con una forma más rectangular o trapezoidal (Fig. IV.7 C, D). A pesar de que
el número de haces vasculares en algunos de los tallos del mutante icu4-1 es menor
que en el silvestre, el área media total de las secciones de los haces (AHV) mutantes es
claramente mayor. Por lo tanto, teniendo en cuenta que el área media de las
secciones de los tallos (AT) mutantes y silvestres es aproximadamente la misma, el
mutante presenta una relación superficie de haz vascular frente a superficie de tallo
claramente mayor que la del silvestre (AHV/AT; Tabla IV.2). En algunas regiones, las
fibras interfasciculares de los mutantes icu4-1 no presentan el típico engrosamiento
de la pared secundaria que se observa en el silvestre (Fig. IV.7 E, F).
Tabla IV.2.- Análisis histológico del tallo del silvestre En-2 y del mutante icu4-1.
Área del
floemaa
(µm²)
Área del
procámbiuma
(µm²)
Área del
xilemaa
(µm²)
ATb
(µm²)
AHVb
(µm²)
AHV / AT
En-2
1.035,53
± 165,96
456,09
± 93,46
4.356,5
± 978,71
454.366,9
± 162.523,7
68.444,99
± 22.536,15
0,152
± 0,018
icu4-1
1.597,96
± 293,64
1.123,05
± 277,05
5.920,36
± 1315,65
451.585,9
± 131.194,8
84.316,94
± 18.708,39
0,190
± 0,018
a
Cada valor representa la media calculada a partir de los datos obtenidos de 10 haces
vasculares del silvestre En-2 y de 10 del mutante icu4-1, de tres tallos de inflorescencia
diferentes ± desviación estándar.
b
Cada valor representa la media calculada a partir de los datos obtenidos de 6 tallos de
inflorescencia del silvestre En-2 y de 6 del mutante icu4-1 ± desviación estándar. AT: Área
media de las secciones de tallo. AHV: Área media del total de haces vasculares por sección de
tallo.
Resultados 77
A
e
en
co
B
Figura IV. 7.- Efectos de la mutación icu4-1
e
en
co
me
hv
me
Sección transversal de En-2. (B) Sección
hv
if
if
en la diferenciación vascular de los tallos. (A)
transversal de icu4-1. (C) Haz vascular de En2. (D) Haz vascular de icu4-1. (E) Fibras
C
D
fl
tr
interfasciculares
tr
fl
de
En-2.
(F)
Fibras
interfasciculares de icu4-1. (G) Gráfica en la
que se representa el número de haces
vasculares de 20 tallos En-2 y de 20 tallos
px
mx
px
pc
pc
E
mx
icu4-1.
co,
corteza;
e,
epidermis;
en,
endodermis; f, floema; hv, haz vascular; if,
fibras interfasciculares; me, médula; mx,
F
metaxilema; pr, procámbium; px, protoxilema;
tr, traqueida. La barra de escala equivale a
if
100 µm en (A) y (B) y a 50 µm en (C), (D), (E)
co
e
if
co
y (F).
e
G
14
12
10
En-2
icu4-1
8
6
4
2
0
5
6
7
8
9
Número de haces vasculares
IV.1.5.- Desarrollo embrionario.
La embriogénesis también está afectada en los mutantes icu4-1 e icu4-2,
hecho que se pudo constatar a través de la visualización de anomalías en los órganos
generados durante esta fase de desarrollo, caso de los cotiledones. Tras la siembra de
cualquiera de los dos mutantes, se observó la aparición de plántulas con un número
anormal de cotiledones o con una morfología alterada. Aproximadamente, el 3% de las
Resultados 78
plantas sembradas presentó tres cotiledones (Fig. IV.8 A), el 1% mostró un solo
cotiledón (Fig. IV.8 B) y otro 1% dos cotiledones fusionados (Fig. IV.8 C).
B
A
C
Figura IV.8.- La mutación icu4-1 causa defectos en la embriogénesis. Mutante icu4-1 con tres cotiledones
(A), un cotiledón (B) o dos cotiledones fusionados (C).
IV.2.- Caracterización fenotípica del doble mutante icu4-1 hst-1.
Previamente,
se
describió
la
interacción
sinérgica
entre
mutaciones
semidominantes icu4 y de pérdida de función en el gen HST (véase el apartado I.6.6),
basándose principalmente en el fenotipo observado en la roseta de los dobles
mutantes icu4-1 hst-5 (Serrano-Cartagena et al., 2000). Para analizar el fenotipo de los
dobles mutantes en otros órganos que pudieran aportar mayor información sobre el
proceso biológico afectado, obtuvimos el doble mutante de icu4-1 con el alelo nulo hst1, un alelo que había sido caracterizado en detalle previamente (Telfer y Poethig,
1998). El mutante hst-1 presenta un fenotipo muy pleiotrópico que consiste en una
aceleración del cambio de fase, un engrosamiento del meristemo apical, una
adaxialización parcial de las hojas y de los órganos florales y una reducción del
crecimiento general de la planta (Telfer y Poethig, 1998; Bollman et al., 2003; Fig. IV.9
A, C).
El doble mutante icu4-1 hst-1 presenta una roseta basal de un tamaño muy
reducido, con unas hojas vegetativas más curvadas que las de los mutantes simples e,
incluso, algunas de ellas radializadas (Fig. IV.9 B). A diferencia de lo que sucede en el
mutante hst-1, el doble mutante es de floración muy tardía y no muestra un adelanto
en el cambio de fase, ya que, tal y como sucede en el mutante simple icu4-1 no
presenta tricomas en la superficie abaxial de los cuatro o cinco primeros pares de
hojas (Fig. IV.9 C, D). Una vez florece, presenta tallos muy finos y, en ocasiones, se
forman rosetas aéreas (Fig. IV.9 E).
Resultados 79
A
B
C
D
E
Figura IV.9.- Fenotipo de la roseta basal y las hojas vegetativas de hst-1 y del doble mutante icu4-1 hst-1.
Roseta de 20 días de hst-1, que ya ha realizado la transición floral, (A) y de icu4-1 hst-1 (B). Hojas
vegetativas del segundo nudo de hst-1 (C), que presenta tricomas en su superficie abaxial, y de icu4-1
hst-1 (D), que carece de los mismos. (E) Roseta aérea de una planta icu4-1 hst-1 50 días después de la
siembra. Las barras de escala equivalen a 50 mm (A) y (E), 25 mm (B) y (C) y 10 mm (D).
Se han caracterizado los fenotipos de pistilos en estadio 12, antes de la
antesis, y de silicuas en estadio 14, después de la antesis (Smyth et al., 1990;
Ferrándiz et al., 1999), mediante microscopía óptica y de barrido (Fig. IV.10). En
estadio 12, los pistilos de En-2 y los de icu4-1 son indistinguibles, mientras que los de
hst-1 están ligeramente aplanados y presentan un estigma de mayor tamaño que el de
su ancestro silvestre, el ecotipo Ler (Fig. IV.10 A-C). Además, en hst-1, los pistilos de
aparición más tardía en la inflorescencia presentan carpelos incorrectamente
fusionados en la parte apical, como se había descrito previamente (Bollman et al.,
2003). En las secciones transversales que hemos realizado en silicuas de estadio 14,
no se observó diferencia alguna entre En-2 e icu4-1. Sin embargo, las silicuas de hst-1
presentan un septum que no se fusiona completamente (Fig. IV.10 I-K).
A pesar del débil fenotipo observado en los pistilos y silicuas de los mutantes
simples, el doble mutante presenta un fuerte fenotipo, consistente en una fusión
reducida de los carpelos, incompleta formación del septum, producción de tejido del
estilo y del estigma en posiciones anormales y la formación de una placenta con
óvulos asociados, un tejido de naturaleza adaxial en el silvestre, en lugar del replum
abaxial (Fig. IV.10 D, E). Se observa también una alteración en la polaridad de los
Resultados 80
óvulos, incluso en los pistilos menos afectados, evidenciada por el fallo del
integumento externo para cubrir completamente al integumento interno y la nucela
(Fig. IV.10 F).
B
A
C
F
E
D
G
H
I
r
v
r
J
v
K
r
v
s
s
s
s
s
v
v
r
r
r
v
Figura IV.10.- Fenotipo del pistilo, del fruto y de los estambres de icu4-1, hst-1 y del doble mutante icu4-1
hst-1. Pistilos de En-2 (A), icu4-1 (B), hst-1 (C) e icu4-1 hst-1 (D, E). (F) Óvulos ectópicos adaxializados
del doble mutante icu4-1 hst-1. Estambre de icu4-1 (G), indistinguible del silvestre (no mostrado), y del
doble mutante (H), que en ocasiones muestra los sacos polínicos en posiciones laterales. Cortes
transversales de ovarios de icu4-1 (I), idéntico al silvestre (no mostrado), hst-1 (J) e icu4-1 hst-1 (K). Las
imágenes fueron tomadas en estadio 12 (A-E, G, H) o 14 (F, I-K). Las barras de escala equivalen a 50 µm
(I-K), 100 µm (A-H)
Resultados 81
Otros órganos florales mostraron asimismo un desarrollo anormal. Mientras que
los estambres del silvestre y los de los mutantes icu4-1 y hst-1 son indistinguibles y
presentan los sacos polínicos en posición normal, en la superficie adaxial, en los
estambres del doble mutante se observa ocasionalmente un desplazamiento de los
sacos polínicos hacia posiciones laterales (Fig. IV.10 G, H). Estas fuertes
transformaciones de estructuras abaxiales en adaxiales en las que está implicado
icu4-1, un alelo de ganancia de función, sugieren que el gen ICU4 codifica un producto
con función adaxial.
IV.3.- Obtención de dobles mutantes con otros genes implicados en el
establecimiento del eje adaxial-abaxial.
Fenotipos similares al observado en los pistilos del doble mutante icu4-1 hst1, de transformación del replum abaxial hacia placenta, ya se habían descrito en los
dobles mutantes que implicaban a alelos de pérdida de función en los genes KAN1 y
KAN2 (véase el apartado I.6.4), CRC (véase el apartado I.6.4), HST y genes como
PICKLE/GYMNOS (PKL/GMN; Ogas et al., 1997; 1999), un factor remodelador de la
cromatina. Estos fenotipos se pueden interpretar como el resultado de una
adaxialización parcial del replum y de los óvulos (Eshed et al., 1999; 2001). Con el fin
de identificar nuevas interacciones genéticas con los alelos semidominantes del gen
ICU4, obtuvimos dobles mutantes de icu4-1 con los alelos de pérdida de función kan12, pkl-1 y crc-1. Los dobles mutantes icu4-1 kan1-2 e icu4-1 pkl-1 mostraron un
fenotipo meramente aditivo, observándose una ligera interacción en el caso del doble
mutante icu4-1 crc-1.
Las silicuas de las plantas homocigotas para el alelo nulo crc-1 son cortas,
ensanchadas, aplanadas, abiertas por el ápice, con un septum incorrectamente
fusionado y muy ocasionalmente presentan un óvulo sobre la superficie del replum
abaxial (Fig. IV.11A, B, F; Alvarez y Smyth, 1999). El fenotipo es ligeramente más
fuerte en las silicuas del doble mutante icu4-1 crc-1, que suelen mostrar una fisura de
gran tamaño en la parte apical por la que se pueden ver claramente los óvulos, y una
mayor frecuencia de óvulos ectópicos (Fig. IV.11 C−E). Tras la observación de 30
frutos procedentes de tres dobles mutantes diferentes se pudo constatar la presencia
de 8 óvulos ectópicos, en el replum abaxial, mientras que ninguno de los 30 frutos crc1 observados presentaron este fenotipo. Además, las silicuas del doble mutante son
más anchas y aplanadas, y muestran una menor fusión del septum que la observada
en las silicuas crc-1 (Fig. IV.11 F, G). Estos resultados indican que el fenotipo mutante
Resultados 82
causado por la homocigosis de crc-1 se ve incrementado por el alelo de ganancia de
función icu4-1.
También se obtuvieron dobles mutantes con el alelo icu4-1 y alelos de pérdida
de función de otros genes implicados directa o indirectamente en el establecimiento
del eje adaxial-abaxial, como AS1 (véase el apartado I.6.2.1) y PNH (véase el
apartado I.6.6). El gen AS1 participa en el establecimiento de la identidad adaxial en la
hoja (Xu et al., 2003), y PNH promueve la actividad del meristemo apical y la
especificación de algunos rasgos adaxiales en la hoja (McConnell y Barton, 1995;
Newman et al., 2002). Los dobles mutantes entre icu4-1 y los alelos as1-1 y pnh-2
mostraron fenotipos meramente aditivos.
D
C
B
A
E
r
F
G
v
r
s
s
s
v
s
v
r
v
Figura IV.11.- Fenotipo de pistilos y silicuas de crc-1 y del doble mutante icu4-1 crc-1. Pistilos de crc-1 (A,
B) y de icu4-1 crc-1 (C, D). (E) Óvulo ectópico de un doble mutante. Cortes transversales de ovarios de crc1 (F) y de icu4-1 crc-1 (G). Las imágenes fueron tomadas en estadio 13 (A-E) y 14 (F, G). Las barras de
escala equivalen a 50 µm (F, G), 100 µm (B, D, E) y 200 µm (A, C).
IV.4.- Caracterización molecular del gen ICU4.
Previamente, se situó el locus en el que se localizaban las mutaciones icu4-1 e
icu4-2 en una amplia región del cromosoma 1. La cartografía de baja resolución
Resultados 83
realizada dio una posición para el gen a 31,5 ±7,0 cM por debajo del marcador
T27K12-Sp6 y 16,9 ±4,5 cM sobre el marcador nga128 (Serrano-Cartagena et al.,
2000).
El análisis de los datos indicó que en la amplia región comprendida entre los
marcadores T27K12-Sp6 y nga128, o cerca de ella, se localizan dos genes candidatos
potenciales a ser los responsables de los fenotipos producidos por los dos alelos
semidominantes del gen ICU4. Uno de ellos es KAN2, un gen del que ya se habían
descrito mutaciones de pérdida de función causantes de transformaciones adaxiales,
esto es, la sustitución de elementos de naturaleza abaxial por estructuras de tipo
adaxial (Eshed et al., 2001). El otro gen, At1g52150, codifica un miembro de la familia
de factores de transcripción HD-ZIP III (véase el apartado I.6.5.2), a la que pertenecen
los genes PHB, PHV y REV, de los que se ha publicado la existencia de diversas
mutaciones semidominantes responsables de transformaciones adaxiales (McConnell
y Barton, 1998; McConell et al., 2001; Emery et al., 2003; Zhong y Ye, 2004). Durante
la realización de este trabajo el gen At1g52150 ha recibido los nombres de ATHB15 y
CNA (Prigge et al., 2005; Green et al., 2005; véase el apartado I.6.5.2).
Dada la naturaleza semidominante de los alelos icu4-1 e icu4-2, una
característica comparable a la de muchos alelos de genes de la familia HD-ZIP III,
adoptamos el gen At1g52150 como el principal candidato. Con el fin de determinar si
el gen ICU4 está localizado en la misma posición genética que el At1g52150, se utilizó
el marcador CER452458 (Cereon Genomics, Monsanto Company), que es polimórfico
entre los ecotipos En-2 y Ler y está situado en el PAC F5F19, el mismo en el que está
el propio gen At1g52150. Se obtuvo una población cartográfica F2 a partir de un
cruzamiento entre el mutante icu4-1 y el ecotipo silvestre Ler (véase el apartado III.11).
Tras el genotipado de 50 individuos de fenotipo silvestre para el marcador
CER452458, los 100 cromosomas analizados mostraron el rasgo polimórfico
correspondiente a Ler, no observándose por tanto recombinación entre el gen y el
marcador. En conclusión, con la resolución de mapeo empleada, el gen ICU4 muestra
un ligamiento absoluto a CER452458. Este resultado indica que ambos ocupan loci
muy cercanos, hecho que es compatible con que ICU4 sea, en efecto, el gen
At1g52150 (ATHB15).
A continuación, se secuenció en los mutantes icu4-1 e icu4-2 la región del gen
ATHB15 con homología a la que presenta las mutaciones semidominantes en otros
genes HD-ZIP III (véase el apartado I.6.5.2). En ambos, se identificó la misma
mutación puntual, una transición G→A en la quinta posición del exón 5,
correspondiente en el mRNA al presunto sitio de unión del miRNA165/166 (Fig. IV.12
A, D), un cambio idéntico al que se produce en algunos alelos semidominantes de los
Resultados 84
genes PHB y PHV (McConnell et al., 2001) y similar al de los alelos semidominantes
de REV (Emery et al., 2001; Zhong y Ye, 2004; Fig. IV.12 D). La mutación causa un
cambio del aminoácido glicina por aspártico en la posición 189 de la proteína, en el
dominio START, una posición muy conservada en las proteínas de la familia HD-ZIP III
de Arabidopsis (McConnell et al., 2001; Rhoades et al., 2002; Fig. IV.12 C). La
secuenciación del resto del gen en el mutante icu4-1 no permitió encontrar ninguna
alteración adicional potencialmente causante de un fenotipo semidominante. Al mismo
tiempo, también se secuenció toda la región codificante el gen KAN2 (At1g32240), no
observándose ninguna mutación, lo que parecía descartar la posibilidad de que icu4-1
e icu4-2 fueran dobles mutantes. Esto supone un dato adicional que señala a ATHB15
como el único gen causante de los fenotipos observados en los mutantes icu4-1 e
icu4-2.
IV.4.1.- Estructura del gen ICU4.
El gen ATHB15/ICU4 está incluido en el clon F5F19 del cromosoma 1, entre las
posiciones 101.401 y 105.449. Tiene una longitud de 4.049 pb y está formado por 18
exones (Fig IV.12 A). Su cDNA consta de 3.437 pb, lo que incluye un líder 5’ no
traducido de 716 pb, una pauta de lectura abierta de 2.511 pb y una cola 3’ no
traducida de 210 pb. En las bases de datos hay depositadas secuencias de 6 cDNA
obtenidos en el ecotipo Col-0, entre las que se distinguen dos transcritos diferentes,
que corresponden a dos proteínas que difieren en un solo aminoácido, NP_175627.1 y
NP_849795.1,
de
836
y
837
aminoácidos,
respectivamente
(NCBI,
http://www.ncbi.nlm.nih.gov/).
La proteína ICU4 contiene los tres dominios característicos de los miembros de
la familia HD-ZIP III: un homeodominio (HOX), entre el residuo 15 y el 75 (Pfam, http://
www.sanger.ac.uk/Software/Pfam/); una cremallera de leucina (BRLZ), del aminoácido
56 al 116, y un dominio START, entre las posiciones 160 y 370 (Fig. IV.12 B). La
proteína ICU4 tiene un porcentaje de identidad con sus parálogos ATHB8, PHB, REV y
PHV del 76, 65, 64 y 63%, respectivamente, y un 86, 78, 77 y 77% de similitud. ICU4
también tiene un gran parecido con las proteínas pertenecientes a la familia HD-ZIP III
de otras especies vegetales como Zinnia elegans o el maíz. Con las proteínas de
Zinnia, presenta una identidad del 80, 79, 74, 65, 64, 64, y 64%, con ZeHB-13, ZeHB2, ZeHB-10, ZeHB-1, ZeHB-3, ZeHB-11 y ZeHB-12, respectivamente, y una similitud
del 88, 87, 85, 78, 77, 77 y 77%; y con la del maíz ROLLED LEAF1 (RLD1), muestra
una identidad y una similitud del 64 y 78%, respectivamente. En principio, los únicos
ortólogos potenciales descritos de ICU4 son los genes ZeHB-13 y ZeHB-2 de Zinnia
elegans, con los cuales comparte exactamente la misma secuencia diana para los
Resultados 85
miRNA165/166 (Fig. IV.12 D). Como puede apreciarse en la Figura IV.12 D, las dianas
de los mRNA de estos tres genes son completamente complementarias al miRNA166,
mientras que las dianas de los mRNA del resto de los genes HD-ZIP III muestran
complementariedad total con el miRNA165.
A
Transición G→A en
icu4-1 e icu4-2
500 pb
Región codificante
Región no codificante
B
HOX
C
ATHB15
ATHB8
PHB
PHV
REV
SIAEETLAEFLSKATGTAVEWVQMPGMKPGPDSIGIIAISHGCTGVAARACGLVGLEPTR
SIADETLTEFISKATGTAVEWVQMPGMKPGPDSIGIVAISHGCTGIAARACGLVGLDPTR
SIAEEALAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVSLEPMK
SIAEETLAEFLCKATGTAVDWVQMIGMKPGPDSIGIVAVSRNCSGIAARACGLVSLEPMK
SIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQRCNGVAARACGLVSLEPMK
***:*:*:**:.*******:**** ********:**.*:*: *.*:********.*:* :
60
60
60
60
60
ATHB15
ATHB8
PHB
PHV
REV
VAEIVKDRPSWFRECRAVEVMNVLPTANGGTVELLYMQLYAPTTLAPPRDFWLLRYTSVL
VAEILKDKPCWLRDCRSLDIVNVLSTANGGTLELIYMQLYAPTTLAPARDFWMLRYTSVM
VAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIELIYTQMYAPTTLAAARDFWTLRYSTCL
VAEILKDRPSWFRDCRCVETLNVIPTGNGGTIELVNTQIYAPTTLAAARDFWTLRYSTSL
IAEILKDRPSWFRDCRSLEVFTMFPAGNGGTIELVYMQTYAPTTLAPARDFWTLRYTTSL
:***:**:*.*:*:**.:: ..::.:.****:**: * *******..**** ***:: :
120
120
120
120
120
ATHB15
ATHB8
PHB
PHV
REV
EDGSLVVCERSLKSTQNGPSMPLVQNFVRAEMLSSGYLIRPCDGGGSIIHIVDHMDLEAC
EDGSLVICERSLNNTQNGPSMPPSPHFVRAEILPSGYLIRPCEGGGSILHIVDHFDLEPW
EDGSYVVCERSLTSATGGPTGPPSSNFVRAEMKPSGFLIRPCDGGGSILHIVDHVDLDAW
EDGSYVVCERSLTSATGGPNGPLSSSFVRAKMLSSGFLIRPCDGGGSIIHIVDHVDLDVS
DNGSFVVCERSLSGSGAGPNAASASQFVRAEMLSSGYLIRPCDGGGSIIHIVDHLNLEAW
::** *:*****..: **. .
****:: .**:*****:*****:*****.:*:
180
180
180
180
180
ATHB15
ATHB8
PHB
PHV
REV
SVPEVLRPLYESPKVLAQKTTMAALRQLKQIAQEVT
SVPEVLRSLYESSTLLAQRTTMAALRYLRQISQEIS
SVPEVMRPLYESSKILAQKMTVAALRHVRQIAQETS
SVPEVLRPLYESSKILAQKMTVAALRHVRQIAQETS
SVPDVLRPLYESSKVVAQKMTISALRYIRQLAQESN
***:*:*.****..::**: *::*** ::*::** .
216
216
216
216
216
Resultados 86
D
miR165
miR166
Arabidopsis thaliana
ATHB15
icu4-1,2
ATHB8
PHB
phb-3d, 4d, 5d
REV
rev-10d, avb-1
rev-σmiRNA
PHV
phv-1d, 2d, 3d, 4d
Zinnia elegans
ZeHB-13
ZeHB-2
ZeHB-10
ZeHB-1
ZeHB-3
ZeHB-12
ZeHB-11
Zea mays
RLD1
Rld1-O
Physcomitrella patens
PpHB10
3’ CCCCCUACUUCGGACCAGGCU 5’
3’ CCCCUUACUUCGGACCAGGCU 5’
5’
5’
5’
5’
5’
5’
5’
5’
5’
5’
CUGGAAUGAAGCCUGGUCCGG
CUGGAAUGAAGCCUGAUCCGG
CUGGGAUGAAGCCUGGUCCGG
UUGGGAUGAAGCCUGGUCCGG
UUGGGAUGAAGCCUGAUCCGG
CUGGGAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCUGG
CUGGGAUGAAGCCUGGACCAG
UUGGGAUGAAGCCUGGUCCGG
UUGGGAUGAAGCCUGAUCCGG
3’
3’
3’
3’
3’
3’
3’
3’
3’
3’
5’
5’
5’
5’
5’
5’
5’
CUGGAAUGAAGCCUGGUCCGG
CUGGAAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCCGG
CUGGGAUGAAGCCUGGUCCGG
3’
3’
3’
3’
3’
3’
3’
5’ CUGGGAUGAAGCCUGGUCCGG 3’
5’ CUGAGAUGAAGCCUGGUCCGG 3’
5’ CUGGUAUGAAGCCUGGUCCGG 3’
Figura IV.12.- Estructura del gen ICU4. (A) Esquema del gen ICU4 en el que se muestra el sitio mutado en
icu4-1 e icu4-2. Los exones están representados por rectángulos y los intrones por las líneas que los
separan. La transcripción tiene lugar de izquierda a derecha. (B) Esquema en el que se representa la
proteína ICU4, con sus dominios conservados. (C) Alineamiento de las secuencias del dominio START de
las proteínas ATHB15, ATHB8, PHB, PHV y REV. Los aminoácidos idénticos a ATHB15 están
sombreados. “*”, residuos idénticos; “:”, sustituciones conservadas; “.” , sustituciones semiconservadas.
(D) Alineamiento de las secuencias de miRNA165, miRNA166 y de sus secuencias diana. Se sombrean
en gris los nucleótidos diferentes a ATHB15 y en rojo las mutaciones descritas.
IV.4.2.- Obtención de plantas transgénicas.
IV.4.2.1.- Sobreexpresión de los cDNA silvestre y mutante del gen ICU4 en las
plantas silvestres En-2.
Para demostrar la implicación del gen ATHB15 en el fenotipo Incurvata4, se
han generado varios tipos de plantas transgénicas, en las que se ha dispuesto el
cDNA silvestre o el cDNA con la mutación presente en los alelos semidominantes, la
mutación de cambio de sentido G189D, bajo el control de una repetición en tándem del
promotor constitutivo 35S del CAMV presente en el vector pBIN-JIT (véase el apartado
III.2; Ferrándiz et al., 2000). Las construcciones han recibido las denominaciones de
35S:ICU4 y 35S:ICU4-G189D. El cDNA silvestre se obtuvo del Riken Genomic
Sciences Center (clon RAFL09-35-K18; Seki et al., 1998; 2002). El cDNA mutante se
ha generado mediante la mutagénesis in vitro del cDNA silvestre tras la amplificación
Resultados 87
por PCR a partir del clon RAFL09-35-K18 con dos parejas de cebadores (véase el
apartado III.10.1). Dos de estos cebadores se han diseñado para crear una transición
G→A en la quinta posición del quinto exón del gen ATHB15. Estas construcciones se
emplearon para la transformación de células de E. coli, realizándose la identificación
de los clones positivos mediante la técnica de hibridación en colonia (véase el
apartado III.8.1), utilizando como sonda la región del cDNA comprendida entre los
cebadores F5F19.21-7 y F5F19.21-8 (véase la tabla III.2). El DNA plasmídico de los
transformantes se empleó para transformar células competentes de la estirpe C58C1
de Agrobacterium tumefaciens. La integridad de las construcciones en los
transformantes se verificó mediante la secuenciación de los segmentos clonados.
Se emplearon entre 100 y 250 plantas En-2 para la transformación mediante
inmersión floral (floral dipping; véase apartado III.10.3). Las semillas resultantes de la
autofecundación de las plantas infiltradas se sembraron en placas de Petri con una
densidad media de 2.500 semillas por placa. Para la selección de las plantas
transgénicas se añadió al medio el antibiótico kanamicina (véase el apartado III.10.4).
Todas las plantas transgénicas que sobreexpresan el cDNA silvestre de ICU4
muestran floración muy tardía, fallos en el patrón de filotaxia y tallos muy gruesos (Fig.
IV.13 A). Ocasionalmente, aparece también alguna hoja vegetativa con los márgenes
foliares ligeramente curvados hacia el haz (Fig. IV.13 B), hojas caulinares sin rama
axilar asociada (Fig. IV.13 C) y pérdida de la dominancia apical (Fig. IV.13 A).
En contraste, se identificaron dos clases de plantas portadoras de la
construcción 35S:ICU4-G189D. Una de ellas incluye individuos fenotípicamente
silvestres, que deben ser el resultado del silenciamiento del transgén, y la otra
comprende una clase con varias plantas que cubren un amplio rango de fenotipos
alterados. A esta última clase pertenecen plantas con las hojas desde moderadamente
curvadas (Fig. IV.14 C) a plantas severamente afectadas (Fig. IV.14 A, B), con hojas
radializadas −aparentemente adaxializadas, ya que presentaban tricomas en toda su
superficie−, sépalos y pétalos también radializados (Fig. IV.14 E, F), y pistilos muy
anormales, con múltiples óvulos y tejidos carpeloides ectópicos, así como disminución
de la fusión de las valvas y falta de diferenciación de la región apical (Fig. IV.14 G, H).
Las plantas con los fenotipos más extremos (Fig. IV.14 A) no llegaron a florecer,
mientras que el resto presentaron una floración muy tardía, por lo que mostraron
rosetas basales con un gran número de hojas vegetativas (Fig. IV.14 E). En estas
últimas plantas se observó también una acusada pérdida de la dominancia apical (Fig.
IV.14 E). Las aberraciones morfológicas mostradas por las plantas transgénicas que
expresan de forma constitutiva el cDNA mutante son del tipo de las transformaciones
adaxiales producidas por los alelos semidominantes icu4-1 e icu4-2, aunque mucho
Resultados 88
más fuertes, lo que constituye una prueba adicional de que el gen ICU4 codifica un
producto con función adaxial.
A
B
C
Figura IV.13.- Fenotipo de las plantas En-2 portadoras de la construcción 35S:ICU4. (A) Planta
transgénica que muestra gran cantidad de hojas vegetativas, tallos muy gruesos, fallos en el patrón de
filotaxia y pérdida de la dominancia apical. (B) Roseta basal que presenta una hoja juvenil con los
márgenes curvados hacia el haz (flecha). (C) Hojas caulinares sin rama lateral asociada. La barra de
escala equivale a 1cm. Las imágenes fueron tomadas 70 (A y C) y 30 (B) días después de la siembra.
IV.4.2.2.- Sobreexpresión de una construcción de interferencia en las plantas
homocigotas icu4-1/icu4-1.
La construcción 35S:ICU4-RNAi se ha diseñado para interferir con el mRNA
endógeno de la planta. Incluye una porción genómica de la región codificante del gen
ICU4 en las dos posibles orientaciones, sentido y antisentido. Para su elaboración, se
amplificaron por PCR dos fragmentos que contenían el mismo segmento genómico y
diferían en las dianas de restricción de sus extremos. Los productos de la
amplificación se ligaron en el vector pCF6 (Cristina Ferrándiz; véase el apartado III.2)
en orientaciones opuestas, quedando separados por el sexto intrón del gen FUL
(véase el apartado I.6.3.3). La posterior transferencia de esta combinación al plásmido
pBIN-JIT, dio lugar a la obtención de la construcción 35S:ICU4-RNAi (véase el
apartado III.10.2). Tras la transformación de células competentes de E. coli, se
identificaron los clones positivos mediante hibridación en colonia (véase el apartado
III.8.1), empleando como sonda la región del cDNA comprendida entre los cebadores
F5F19.21-10 y F5F19.21-11, que amplifican el segmento genómico utilizado para la
obtención de la construcción (véase la tabla III.2). El DNA plasmídico de los
transformantes se introdujo en la estirpe C58C1 de Agrobacterium tumefaciens,
Resultados 89
empleándose las bacterias con los plásmidos recombinantes para la transformación de
plantas mutantes icu4-1, que se realizó de igual forma a la comentada en el apartado
anterior para las plantas silvestres, una vez que se verificó la integridad de la
construcción mediante secuenciación.
A
B
C
D
E
F
G
H
Figura IV.14.- Fenotipo de las plantas En-2 portadoras de la construcción 35S:ICU4-G189D y de una
planta icu4-1 con la construcción de interferencia. Plantas En-2 portadoras de la construcción 35S:ICU4G189D con la mayoría de sus hojas radializadas (A), con un fenotipo menos severo (B) y con un fenotipo
Incurvata moderado (C). (D) Planta icu4-1 con la construcción de interferencia, mostrando hojas
aplanadas. La planta B, después de la transición floral, presentó órganos florales radializados (E-F) y
pistilos anormales (G-H). Las barras de escala indican 1mm (A-D), 1 cm (E), 0,5 cm (F) y 0,5 mm (G-H).
Las imágenes fueron tomadas 40 (A), 35 (B), 25 (C), 15 (D) y 90 (E-F) días después de la siembra. Los
pistilos están aproximadamente en estadio 13 (G-H).
Se observaron dos tipos de fenotipos entre las plantas transformantes. Plantas
transgénicas con rosetas de fenotipo moderadamente Incurvata y resistencia parcial a
la kanamicina, probablemente debidas al silenciamiento parcial del transgén, y plantas
con rosetas de fenotipo silvestre (Fig. IV.14 D). Esta supresión del fenotipo mutante en
los homocigotos icu4-1 es consistente con las hipótesis de que el alelo semidominante
se debe a una mutación de ganancia de función y de que el gen ATHB15 es el
responsable del fenotipo observado en los mutantes icu4-1 e icu4-2. Las plantas En-2
Resultados 90
portadoras de la construcción 35S:ICU4-RNAi no mostraron ningún fenotipo mutante
observable.
IV.4.3.- Análisis de la expresión del gen ICU4.
Analizamos la expresión de ICU4 mediante hibridación in situ en tallos de
inflorescencia de En-2 e icu4-1 a 1 cm del meristemo apical, zona en la que se están
formando los haces vasculares, y en la parte media de la inflorescencia, en entrenudos
que ya han alcanzado su longitud final (véase el apartado III.8.2). El resultado parece
confirmar datos que indican que el gen se expresa con mayor intensidad en el mutante
(José Luis Micol, comunicación personal). Además, tal y como se ha visto para el alelo
semidominante phb-1d (McConnell et al., 2001), la expresión del alelo icu4-1 persiste
en regiones en las que se detecta normalmente ICU4 en el silvestre durante estadios
tempranos y deja de hacerlo a lo largo del desarrollo, lo que implica la expresión
ectópica del gen en el mutante.
A
B
C
D
Figura IV.15.- Análisis de la expresión del gen ICU4 en tallos de inflorescencia de En-2 y de icu4-1
mediante hibridación in situ. Cortes transversales de tallos de inflorescencia de En-2 (A) e icu4-1 (B), a 1
cm del meristemo apical y en la parte media de tallos de inflorescencia de En-2 (C) e icu4-1 (D) en los que
se observa el patrón de expresión de ICU4 . Las barras de escala equivalen a 100 µm (A-B) y 250 µm (CD).
En las secciones transversales obtenidas a 1 cm del meristemo apical, es decir,
durante una etapa inicial del desarrollo del tallo, ICU4 se expresa en un dominio
amplio que incluye principalmente la epidermis, el tejido vascular en formación y la
médula, tanto en el silvestre como en el mutante icu4-1 (Fig. IV.15 A, B). Estos
resultados coinciden con los obtenidos por Prigge y colaboradores (2005).
En un estadio más avanzado del desarrollo del tallo, como son los entrenudos
que han dejado de elongarse, la expresión en el silvestre parece restringirse a una
débil señal en la epidermis y a la eustela, observándose la tinción en el procámbium y
el xilema de los haces vasculares y en las fibras interfasciculares. La señal en el
mutante icu4-1 es algo diferente, ya que ésta es mucho más fuerte que en el silvestre,
observándose además un cierta expresión en la región del floema y la persistencia de
la tinción en la médula (Fig. IV.15 C, D).
Resultados 91
IV.5.- Análisis de las interacciones genéticas entre ICU4 y otros miembros de la
familia HD-ZIP III.
IV.5.1.- Obtención de alelos de pérdida de función.
Con el fin de obtener alelos de pérdida de función, se realizó una búsqueda de
líneas de inserción de T-DNA en las colecciones de dominio público. Se encontraron
dos líneas de la colección Salk Institute T-DNA insertion collection (Alonso et al., 2003)
con inserciones en el gen ICU4, las líneas SALK_045175 y SALK_013134. La primera
contiene una inserción de T-DNA a 755 pb del codón de inicio, muy cerca del punto en
el que comienza la transcripción, y la segunda contiene una inserción en la región 3’
no traducida, a 107 pb del codón de parada (Fig. IV.16 A; base de datos SIGnal). Se
ha confirmando la presencia y la posición de las inserciones mediante amplificación
por PCR (véase el apartado III.12). Las líneas SALK_045175 y SALK_013134 son, por
tanto, posibles portadoras de alelos nulos que hemos denominado icu4-5 e icu4-4,
respectivamente. En el laboratorio de J.L. Micol se ha descrito un alelo adicional de
pérdida de función (icu4-3), que corresponde a la línea de T-DNA SALK_017186, que
lleva una inserción en el segundo exón del gen. Ninguno de estos tres alelos causa
fenotipo mutante en homocigosis. Este dato es similar a las descripciones
anteriormente publicadas de homocigotos para los alelos de pérdida de función de
otros miembros de la familia HD-ZIP III, como athb8-1, athb8-2, cna-2, phb-6 y phv-5
(Baima et al., 2001; Emery et al., 2003; Prigge et al., 2005), que no mostraron ningún
fenotipo mutante, hecho que se ha explicado aduciendo la existencia de redundancia
funcional entre los distintos genes de la familia. Entre éstos, el gen REV es el único
cuyos alelos de pérdida de función muestran un fenotipo alterado en homocigosis
(véase el apartado I.6.5.2).
IV.5.2.- Análisis de los dobles mutantes icu4 athb8.
Como se ha mencionado en el apartado anterior, se ha argumentado que la
ausencia de fenotipos mutantes en los individuos homocigotos para los alelos de
pérdida de función de los miembros de la familia HD-ZIP III se debe a la redundancia
funcional de estos genes (Emery et al., 2003; Prigge et al., 2005). El gen ATHB8
(At4g32880) es el parálogo más cercano a ICU4 en Arabidopsis.
Con el propósito de obtener dobles mutantes para alelos de pérdida de función
de los dos genes, se realizó también una búsqueda de líneas con inserciones de TDNA en ATHB8. Una línea de la colección GABI-Kat (Rosso et al., 2003; Sthrizov et
al., 2003; Li et al., 2003), la línea GABI_256E07, contiene una inserción de T-DNA en
la región 3’ no traducida del gen ATHB8, a 11 pb del codón de parada (Fig. IV.16 B),
Resultados 92
que le confiere resistencia al antibiótico sulfadiacina. La línea es, por lo tanto,
portadora de un posible alelo nulo del gen ATHB8 al que hemos llamado athb8-6. La
homocigosis de este alelo tampoco causa fenotipo mutante. Así mismo, las plantas
homocigotas dobles icu4-5 athb8-6, obtenidas en la F2 de un cruzamiento entre
parentales que eran homocigotos simples para los dos alelos, tampoco muestran
fenotipo mutante alguno.
A
icu4-5
icu4-4
500 pb
Región codificante
Región no codificante
B
athb8-6
500 pb
Región codificante
Región no codificante
Figura IV.16.- Localización de las inserciones de T-DNA de los alelos icu4 y athb8. (A) Esquema del gen
ICU4 en el que se muestra el sitio de la inserción en icu4-4 e icu4-5 (triángulo rojo). Los exones están
representados por rectángulos y los intrones por las líneas que los separan. La trancripción tiene lugar de
izquierda a derecha. (B) Esquema similar del gen ATHB8, en el que se marca el sitio de la inserción en el
alelo athb8-6.
IV.5.3.- Análisis de los dobles mutantes icu4-1 rev.
La homocigosis para los alelos de pérdida de función del gen REV produce un
fenotipo mutante que consiste fundamentalmente en la carencia de meristemos
axilares y de fibras interfasciculares, defectos en el desarrollo de los meristemos
florales y un mayor tamaño general de la planta y de todos sus órganos (Fig. IV.17 A;
Talbert et al., 1995; Zhong y Ye, 1999; Otsuga et al., 2001; véase el apartado I.6.5.2).
Se han obtenido dobles mutantes entre el alelo de ganancia de función icu4-1 y
los alelos de pérdida de función del gen REV, rev-1 y rev-6 (Fig. IV.17; Talbert et al.,
1995). Los dobles mutantes rev-1 icu4-1 y rev-6 icu4-1 muestran una sorprendente
recuperación del fenotipo mutante Revoluta hacia un fenotipo más parecido al silvestre
en varios de sus rasgos. A diferencia de los mutantes rev de pérdida de función, los
dobles mutantes presentan meristemos axilares asociados a la mayoría de las hojas
Resultados 93
caulinares, formándose ramas laterales a partir de ellos, y un desarrollo normal de las
flores (Fig. IV.17 A). Además, muestran una floración muy tardía, dando lugar a
rosetas basales con gran cantidad de hojas vegetativas de bordes aserrados (Fig.
IV.17 B). Ocasionalmente, también se forman rosetas aéreas (Fig. IV.17 C).
A
B
C
Figura IV.17.- Fenotipos del doble mutante icu4-1 rev-1. (A) Plantas rev-1 (izquierda) e icu4-1 rev-1
(derecha). Las plantas rev-1 presentan meristemos florales que no son capaces de formar flores (flecha
roja) y carecen de meristemos axilares (flecha azul). Estos fenotipos se recuperan en el doble mutante,
que produce flores que se desarrollan de forma normal (flecha roja) y ramas axilares (flecha azul). (B)
Roseta basal de un doble mutante que presenta gran cantidad de hojas aserradas. (C) Roseta aérea
formada en el tallo principal de inflorescencia de un doble mutante. Las barras de escala equivalen a 1 cm.
Las imágenes fueron tomadas 60 (A y C) y 40 días después de la siembra (B).
IV.5.4.- Análisis de los dobles mutantes icu4-1 phb1-d.
El alelo semidominante phb-1d se debe a una mutación de ganancia de función
en el gen PHB que produce la transformación de los tejidos abaxiales de los órganos
laterales en adaxiales (McConnell y Barton, 1998; véase los apartados I.6.4 y I.6.5.2).
Las plantas heterocigotas PHB/phb-1d exhiben un grado variable de simetría radial en
todos los sus órganos laterales y tienen un porte arbustivo, debido a la formación de
yemas axilares ectópicas cercanas a las regiones de las hojas con identidad adaxial
(Fig. IV.18 A; McConnell y Barton, 1998). Dada la elevada similitud en las secuencias
de los productos ICU4 y PHB, así como el parecido entre los alelos semidominantes
phb-1d e icu4-1, esperábamos una intensificación mutua de los fenotipos mutantes en
los dihíbridos ICU4/icu4-1;PHB/phb-1d. Sorprendentemente, estas plantas no
mostraron el fuerte fenotipo que se esperaba. Por el contrario, los dobles heterocigotos
presentan un fenotipo más débil. Son plantas menos arbustivas, debido a la formación
de un número menor de meristemos ectópicos, y con los órganos laterales menos
Resultados 94
adaxializados que en el heterocigoto PHB/phb-1d, lo que implica que el alelo icu4-1
suprime parcialmente el fenotipo causado por la mutación phb-1d (Fig. IV.18 B). Para
descartar la posible influencia del fondo genético En-2 en la expresividad de la
mutación phb-1d, se cruzaron plantas heterocigotas PHB/phb-1d por En-2,
observándose que los individuos heterocigotos de la F1 presentaban un fenotipo
similar al de sus parentales mutantes.
A
B
Figura IV.18.- Disminución del fenotipo causado por la mutación phb-1d en el doble heterocigoto ICU4/
icu4-1;PHB/phb-1d. (A) Heterocigoto PHB/phb-1d. (B) Doble heterocigoto ICU4/icu4-1;PHB/phb-1d. Las
barras de escala equivalen a 5 mm. Las imágenes fueron tomadas 60 días después de la siembra.
IV.6.- Análisis de los dobles mutantes icu4-1 fil-3.
FILAMENTOUS FLOWER (FIL), un gen perteneciente a la familia de genes
YABBY (véase el apartado I.6.4), se expresa en el dominio abaxial de todos los
órganos laterales, y regula el tiempo de floración, el desarrollo de los meristemos de
inflorescencia y florales y el establecimiento de la identidad abaxial en los órganos
laterales (Chen et al., 1999; Sawa et al., 1999a; 1999b). Con el fin de estudiar la
existencia de una posible interacción génica entre los genes ICU4 y FIL, se han
obtenido dobles mutantes para icu4-1 y el alelo débil de pérdida de función fil-3. Las
plantas homocigotas fil-3 presentan floración temprana, órganos florales parcialmente
adaxializados y débiles defectos en la formación de las flores (Fig.IV.19 A). El doble
mutante icu4-1 fil-3 tiene floración tardía, fallos en la filotaxia, pérdida de la dominancia
apical y pedicelos y entrenudos muy largos. Este último fenotipo se debe
probablemente a una disminución respecto al mutante simple fil-3 en la capacidad de
formar flores (Fig. IV.19 B), característica que presentan también los alelos nulos de
Resultados 95
FIL, como fil-5 (Chen et al., 1999). Además, las transformaciones adaxiales son
también más fuertes en el doble mutante. Por lo tanto, el alelo icu4-1 parece
incrementar el fenotipo alterado debido a la pérdida parcial de la función FIL de los
homocigotos fil-3.
A
B
Figura IV.19.- Fenotipo de fil-3 y del doble mutante icu4-1 fil-3. (A) Planta fil-3 y (B) planta icu4-1 fil-3 que
presenta pérdida de la dominancia apical, entrenudos y pedicelos muy largos y fallos de filotaxia. Las
imágenes fueron tomadas 60 días después de la siembra. La barra de escala equivale a 1 cm.
IV.7.- Estudio de la función del gen ICU4 en la filotaxia.
El mutante icu4-1 presenta fallos en la filotaxia (véase el apartado IV.2.2),
rasgo que se ve incrementado en algunos de los dobles mutantes obtenidos, casos de
los dobles icu4-1 hst-1, icu4-1 rev-1 e icu4-1 fil-3. Para estudiar en qué procesos
implicados en la formación del patrón correcto de filotaxia fallan los mutantes con
alelos semidominantes de ICU4, se han analizado las interacciones génicas entre
ICU4 y otros genes necesarios para la especificación del patrón de filotaxia, como los
genes PENNYWISE (PNY) y BREVIPEDICELLUS (BP; Smith y Hake, 2003). PNY
codifica una proteína con homeodominio similar al producto BEL1 (proteínas BELL) y
BP, también conocido como KNAT1, es un gen KNOX de clase I (Douglas et al., 2002;
Venglat et al., 2002; véase el apartado I.6.2.1). Las proteínas KNOX interaccionan con
las BELL para unirse con elevada afinidad a una secuencia diana de DNA, actuando
como factores de transcripción y regulando así diversos procesos. Los mutantes de
pérdida de función en ambos genes presentan anomalías en el patrón de filotaxia,
Resultados 96
mostrando una gran variación en la longitud de los entrenudos. Estos defectos se ven
fuertemente incrementados en el doble mutante pny-40126 bp-9 (Smith y Hake, 2003).
IV.7.1.- Análisis del patrón de filotaxia de los dobles mutantes icu4-1 pny-40126.
El alelo pny-40126 contiene una inserción de T-DNA en el primer intrón del gen
PNY (At5g02030). Los individuos homocigotos para este alelo presentan una
inflorescencia de menor estatura que la de su ancestro silvestre, el ecotipo Col-0, la
pérdida parcial de la dominancia apical y una variabilidad notable en la longitud de los
entrenudos, lo que conlleva la colocación de varias hojas caulinares o de varias
silicuas en el mismo punto (Fig. IV.20 A). Este fenotipo se ve incrementado en el
doble mutante icu4-1 pny-40126, en el que la longitud de los entrenudos es mucho
más variable que en los mutantes simples, llegándose a formar rosetas aéreas de las
que parten varias ramas laterales (Fig. IV.20 B).
A
B
Figura IV.20.- Fenotipo de pny-40126 y del doble mutante icu4-1 pny-40126. (A) Planta pny-40126 y (B)
planta icu4-1 pny-40126 que presenta una roseta aérea y una longitud anormal de los entrenudos. Las
imágenes fueron tomadas 50 días después de la siembra. La barra de escala equivale a 1 cm.
Resultados 97
IV.7.2.- Análisis del patrón de filotaxia de los dobles mutantes icu4-1 bp-1.
El alelo bp-1 se obtuvo mediante mutagénesis con EMS en fondo Ler
(Koornneef et al., 1983). Los individuos homocigotos para este alelo se caracterizan
por una disminución en la estatura de la inflorescencia, fenotipo causado por un menor
crecimiento de los entrenudos. Los pedicelos también son más cortos y las flores
están orientadas hacia abajo debido a un mayor crecimiento de la región adaxial del
pedicelo respecto a la abaxial (Fig. IV.21 A; Douglas et al., 2002). Todos estos
fenotipos se ven intensificados en el doble mutante icu4-1 bp-1, que presenta unos
entrenudos y unos pedicelos más cortos que los del mutante bp-1, así como una
mayor orientación de las flores hacia abajo, de manera que las silicuas formadas tras
la polinización adoptan una disposición prácticamente en paralelo con el tallo (Fig.
IV.21 B). El doble mutante es también de floración tardía, lo que se traduce en un
mayor número de hojas en la roseta basal (Fig. IV.21 B).
A
B
Figura IV.21.- Fenotipo de bp-1 y del doble mutante icu4-1 bp-1. (A) Planta bp-1 y (B) planta icu4-1 bp-1
que presenta un menor crecimiento de los entrenudos y de los pedicelos. Las imágenes fueron tomadas
50 días después de la siembra. La barra de escala equivale a 1 cm.
IV.8.- Estudio de la función del gen ICU4 en el desarrollo vascular.
Los mutantes icu4-1 presentan un patrón vascular del tallo alterado (véase el
apartado IV.3.4). Con el fin de inferir la función del gen ICU4 en la formación del patrón
vascular correcto, se ha realizado el análisis de las posibles interacciones génicas
entre el alelo icu4-1 y los alelos de genes que intervienen en el establecimiento del
patrón vascular y/o el desarrollo correcto de la inflorescencia.
Resultados 98
IV.8.1.- Análisis del patrón vascular de los dobles mutantes icu4-1 phb-1d.
Los individuos homocigotos para el alelo de ganancia de función phb-1d
presentan hojas adaxializadas, en muchas de la cuales es posible observar venas con
un patrón anfivasal (xilema rodeando al floema) a causa de la adaxialización producida
por la expresión ectópica del gen PHB (McConnell y Barton, 1998; McConnell et al.,
2001). En las condiciones de cultivo empleadas en nuestro laboratorio, no se ha
conseguido que florezca ningún individuo homocigoto phb-1d/phb-1d, por lo que se
han obtenido cortes transversales de la parte media del tallo de los individuos
heterocigotos PHB/phb-1d. La mayoría de los haces vasculares observados en estos
cortes son colaterales, aunque ocasionalmente aparece algún haz total o parcialmente
anfivasal (Fig. IV.22 A). En el caso del doble heterocigoto ICU4/icu4-1;PHB/phb-1d, el
fenotipo anterior se ve incrementado, ya que todos los haces vasculares adoptan un
patrón completa o parcialmente anfivasal (Fig. IV.22 B, C). Este incremento del
fenotipo mutante contrasta con el descrito previamente para la adaxialización de los
órganos laterales, donde se observaba una reducción del fenotipo del doble
heterocigoto con respecto al heterocigoto PHB/phb-1d (véase el apartado IV.6.4).
IV.8.2.- Análisis del patrón vascular de los dobles mutantes icu4-1 hst-1.
Como ya se ha mencionado anteriormente, los mutantes de pérdida de función
del gen HST muestran un fenotipo muy pleiotrópico (véase el apartado IV.2), de
manera que se han realizado cortes histológicos de los tallos de individuos
homocigotos para el alelo nulo hst-1, con el objetivo de comprobar si éstos también
presentan un patrón radial alterado. Los tallos de las plantas hst-1 no muestran
ninguna anomalía apreciable, con la excepción de que suelen observarse patrones
anormales de crecimiento de las células epidérmicas, que son de mayor tamaño que
las de los tallos silvestres y, a veces, son de un tamaño similar a las de la corteza (Fig.
IV.22 D). A pesar del débil fenotipo mostrado por las plantas hst-1, en los dobles
mutantes icu4-1 hst-1 se observa una gran desorganización de todos los tipos
celulares que conforman el patrón radial del tallo. Presentan tan sólo dos o tres haces
vasculares anfivasales situados en la médula, no siendo posible distinguir la eustela, y
en algunas regiones aparecen parches de fibras interfasciculares que no están
correctamente lignificadas (Fig. IV.22 E, F).
IV.8.3.- Análisis del patrón vascular de los dobles mutantes phb-1d hst-1.
Con el objetivo de comprobar si hay también sinergia entre las mutaciones
semidominantes de PHB y de pérdida de función en HST, se han obtenido plantas
PHB/phb-1d;hst-1/hst-1. Éstas presentan una desorganización aún mayor en el patrón
Resultados 99
radial del tallo que la observada en los dobles mutantes icu4-1 hst-1. Los tallos
muestran un diámetro muy reducido, que se debe al escaso tejido vascular que
presentan y a una gran disminución en el número de todos los tipos celulares, y
cambios en la morfología de éstos con respecto al silvestre. El tejido vascular no
adopta ningún patrón ordenado, estando situado en el centro del tallo rodeado de
parénquima medular y sin formar una eustela. Aparecen algunos tipos celulares nunca
observados en un tallo silvestre, siendo de destacar las células alargadas de la
corteza, justo debajo de la epidermis, y que recuerdan a las células del mesófilo en
empalizada característico de las regiones adaxiales de las hojas y los cotiledones (Fig.
IV.22 G, H).
IV.8.4.- Análisis del patrón vascular de los dobles mutantes icu4-1 fil-3.
Se han realizado cortes transversales de los tallos de individuos homocigotos
para el alelo débil de pérdida de función fil-3. Éstos presentan un fenotipo
prácticamente normal, salvo por una reducción en el número de haces vasculares
situados en la eustela, que además presentan una cierta distribución espacial irregular
(Fig. IV.22 I). Así, mientras que en el silvestre están distribuidos de forma homogénea,
siendo aproximadamente igual la separación entre haces vasculares contiguos, en el
mutante fil-3 esta separación es más irregular, estando unos haces muy juntos y otros
muy separados. El doble mutante icu4-1 fil-3 presenta una separación irregular de los
haces vasculares que, asimismo, aparecen en un número menor del observado en los
individuos homocigotos icu4-1 (Fig. IV.22 J).
IV.8.5.- Análisis del patrón vascular de los dobles mutantes icu4-1 rev.
Los individuos homocigotos para los alelos de pérdida de función del gen
REV carecen de fibras interfasciculares en algunos fondos genéticos, como Col-0 o
No-0, fondos en los que se encuentran los dos alelos de pérdida de función de los que
disponemos, rev-6 y rev-1, respectivamente (Fig. IV.22 K; Talbert et al., 1995; Zhong y
Ye, 1999; Ratcliffe et al., 2000). El fenotipo de ausencia de las fibras interfasciculares
se recupera en los dobles mutantes icu4-1 rev-1 e icu4-1 rev-6, en los que sí se
observan estas fibras, aunque con una pared secundaria poco diferenciada, lo que se
traduce en un reducido engrosamiento, tal y como sucede en los individuos icu4-1
(Fig. IV.22 L; véase el apartado IV.3.4). Para descartar la posibilidad de que la
formación de fibras interfasciculares en los mutantes rev fuera posible en la mezcla de
fondos genéticos En-2 y Col-0 o No-0 en los que están los dobles mutantes, hemos
cortado tallos de plantas rev obtenidas de las mismas F2 de las que se aislaron los
dobles mutantes y que, por tanto, comparten fondos genéticos con éstos, observando
Resultados 100
que tampoco se forman las fibras interfasciculares en ellos. Este resultado indica que
la mutación de ganancia de función icu4-1 es capaz de recuperar el fenotipo de
ausencia de fibras interfasciculares causado por las mutaciones de pérdida de función
rev-1 y rev-6.
A
B
C
D
E
F
G
H
I
J
K
L
Figura IV.22.- Cortes transversales de tallos de inflorescencia de algunos dobles mutantes que
muestran un fenotipo alterado. Tallos del heterocigoto PHB/phb-1d (A) y del doble heterocigoto
PHB/phb-1d;ICU4/icu4-1 (B). (C) Haz vascular anfivasal del mismo doble heterocigoto. Tallos del
mutante hst-1 (D) y del doble mutante hst-1 icu4-1 (E). (F) Haz vascular anfivasal del doble mutante hst1 icu4-1. Tallo (G) y haz vascular anfivasal (H) de un individuo PHB/phb-1d;hst-1/hst-1. Tallos del
mutante fil-3 (I) y del doble mutante icu4-1 fil-3 (J). Secciones transversales que muestran la ausencia
de fibras interfasciculares en rev-1 (K), y la presencia de las mismas en el doble mutante icu4-1 rev-1
(L). La barra de escala equivale a 50 µm en (C, F, H), 100 µm en (E, G, J-L) y 250 µm en (A, B, D, I).
Resultados 101
IV.8.6.- Análisis del patrón vascular de las plantas transgénicas 35S:ICU4 y
35S:ICU4-G189D.
Las plantas transgénicas En-2 que sobreexpresan el cDNA silvestre de ICU4
presentan unos tallos muy gruesos, con un número muy elevado de haces vasculares,
que oscila entre 13 y 14, y más filas de fibras interfasciculares que los tallos silvestres.
Los haces vasculares de estas plantas transgénicas son, a su vez, de gran tamaño,
mostrando capas adicionales de procámbium, xilema y floema (Fig. IV.23 A-C).
Las plantas transgénicas En-2 que sobreexpresan el cDNA mutante de icu4-1
presentan haces vasculares con un patrón anfivasal (Fig. IV.23 D, E) y, al igual que
ocurre en los homocigotos icu4-1, muestran fibras interfasciculares con defectos en la
lignificación (Fig. IV.23 F).
Los mutantes de pérdida de función icu4-4 e icu4-5, las plantas que
sobreexpresan la construcción de interferencia y los dobles mutantes icu4-5 athb8-6
no muestran fenotipo mutante en el tallo.
A
D
B
E
C
F
Figura IV.23.- Cortes transversales de tallos de inflorescencia de plantas transgénicas En-2 que
sobreexpresan el cDNA silvestre de ICU4 y el cDNA mutante de icu4-1. (A) Tallo de inflorescencia de una
planta En-2 portadora de la construcción 35S:ICU4. (B) Haz vascular de la planta anterior. (C) Fibras
interfasciculares de la misma planta. (D) Tallo de inflorescencia de una planta En-2 portadora de la
construcción 35S:ICU4-G189D. (E) Haz vascular anfivasal de la misma planta. (F) Fibras interfasciculares,
que muestran una lignificación menor en la zona señalada con la flecha. Las barras de escala representan
250 µm (A), 100 µm (B, D) y 50 µm (C, E, F).
Resultados 102
IV.8.7.- Efectos de las auxinas y de los inhibidores de su transporte en el
desarrollo del patrón vascular.
El transporte polar de las auxinas desempeña un papel fundamental en la
formación del patrón que adopta el tejido vascular vegetal (Sachs, 1981; 1991; Bennet
et al., 1998; Berleth y Mattson, 2000; Ye, 2002; véase el apartado I.6.3.1.2). Con el fin
de estudiar la relación existente entre la señalización de auxinas y la función del gen
ICU4, se han realizado distintos tratamientos a plantas En-2 e icu4-1 con la auxina
sintética NAA o con el inhibidor del transporte de auxinas NPA (véase el apartado
III.13).
El tratamiento de las plantas En-2 con 1 µM de NAA, la máxima concentración
empleada de la auxina sintética, produce una disminución en el número de haces
vasculares. Éstos son de mayor tamaño que los controles no tratados, presentando
más capas de procámbium y, como consecuencia, una mayor producción de floema y
de xilema, especialmente de metaxilema. En algunas zonas localizadas entre los
haces vasculares, las fibras interfasciculares se hallan débilmente lignificadas (Fig.
IV.24 A, B). Este fenotipo mimetiza el que presentan los homocigotos icu4-1 (véase el
apartado IV.3.4). En el caso del mutante icu4-1, este tratamiento intensifica su
fenotipo, observándose un número aún menor de haces vasculares, tan sólo 3 o 4, así
como un incremento en el número de fibras interfasciculares escasamente engrosadas
(Fig. IV.24 C). En los tratamientos con menores concentraciones se observan los
mismos efectos, aunque los fenotipos son menos fuertes.
Tal y como se ha descrito previamente, el tratamiento de las plantas silvestres
con la máxima concentración de NPA utilizada, 40µM, tiene como resultado una gran
expansión del tejido vascular, que prácticamente forma un anillo continuo debido al
ensanchamiento de los haces vasculares, viéndose muy reducida la región ocupada
por el parénquima medular (Gälweiler et al., 1998; Mattsson et al., 1999; Zhong y Ye,
2001). Sin embargo, este tejido vascular está pobremente diferenciado, no siendo
posible distinguir claramente el metaxilema (Fig. IV.24 D). En los homocigotos icu4-1,
además de esta notable formación de tejido vascular poco diferenciado, se observan
algunos haces vasculares anfivasales que, en ocasiones, no se sitúan a la misma
altura dentro de la eustela, sino que adoptan posiciones más internas en ésta y más
cercanas a la médula, próximas a la zona central del tallo (Fig. IV.24 E, F). Los
tratamientos con menores concentraciones de NPA dan lugar a los mismos fenotipos,
si bien más débiles que los descritos para la concentración de 40µM.
Los fenotipos observados con los tratamientos con NAA o NPA en el silvestre
indican que las auxinas participan en la elaboración del patrón radial de los tallos. Las
modificaciones que producen estos tratamientos sobre el fenotipo del mutante icu4-1
Resultados 103
sugieren que el efecto de las auxinas sobre el patrón radial de los tallos está modulado
por el gen ICU4, de modo que podría existir algún tipo de coordinación entre la
señalización por auxinas y la función de los genes HD-ZIP III para el establecimiento
de patrones morfogenéticos.
A
B
C
D
E
F
Figura IV.24.- Efectos de los tratamientos de plantas En-2 e icu4-1 con NAA 1µM y NPA 40 µM. Cortes
transversales de tallos de plantas En-2 (A, B) e icu4-1 (C) tratadas con NAA. Cortes transversales de
tallos de plantas En-2 (D) e icu4-1 (E, F) tratadas con NPA. Las barras de escala indican 100 µm.
V.- Discusión
Discusión 105
V.- Discusión
V.1.- icu4-1 e icu4-2 son dos alelos semidominantes del gen ICU4.
Los mutantes morfológicos constituyen una herramienta muy valiosa para la
identificación de los genes que participan en el desarrollo y para la inferencia de sus
funciones. Una de las mayores colecciones disponibles de mutantes morfológicos de
Arabidopsis thaliana es la denominada Arabidopsis Information Service Form Mutants,
que actualmente está depositada en el NASC (Nottingham Arabidopsis Stock Center).
Laibach, en la década de los 30 del siglo pasado, recolectó los primeros especímenes
de la colección. Con posterioridad, otros investigadores fueron añadiendo nuevos
mutantes, casos de Röbbelen (N300-N420) y de Rattcliffe, Gómez-Campo y Kranz
(N430-462; Bürger, 1971; Kranz, 1978).
En el laboratorio de J.L. Micol, se ha llevado a cabo un importante estudio de
mutantes de esta colección con morfología foliar alterada, los cuales han sido
agrupados en 13 clases fenotípicas con el objeto de simplificar el análisis genético
(Serrano-Cartagena et al., 1999). Una de estas clases, la denominada Incurvata (Icu),
se caracteriza por presentar los márgenes foliares curvados hacia el haz (Berná et al.,
1999; Serrano-Cartagena et al., 2000). La clase incluye 22 líneas que pertenecen a 10
grupos de complementación diferentes (Serrano-Cartagena et al., 1999), dos de los
cuales, INCURVATA1 (ICU1) e ICU3, corresponden a los genes previamente descritos
CURLY LEAF (CLF; Goodrich et al., 1997) y HASTY (HST; Telfer y Poethig, 1998),
respectivamente. Todos los alelos mutantes de los genes Icu son recesivos, con la
excepción de los dos de ICU4, icu4-1 e icu4-2, que son semidominantes, el de ICU5,
que es dominante, y el de ICU6, que se transmite con un patrón de herencia de
letalidad recesiva con efecto fenotípico en el heterocigoto (Serrano-Cartagena et al.,
2000; Robles, 2000).
La semidominancia de los alelos icu4-1 e icu4-2 podría deberse a mutaciones
de ganancia de función, a la haploinsuficiencia de mutaciones de pérdida de función o
a mutaciones con comportamiento antimorfo (dominante negativo). Para poder
interpretar la semidominancia de estos alelos, se llevó a cabo un análisis de dosis
(Timpte et al., 1994) en un triploide portador de una única copia del alelo mutante icu41 y dos del silvestre. Si se tratara de mutaciones de ganancia de función, un único
alelo
mutante
debería
dar
el
fenotipo
característico
del
heterocigoto,
independientemente del número de alelos silvestres. En el caso de que el locus fuera
haploinsuficiente, el fenotipo dependería exclusivamente del número de alelos
Discusión 106
funcionales, un mínimo de dos para obtener el fenotipo normal. Finalmente, si los
alelos mutantes fueran antimorfos, se debería tener en cuenta que la dominancia de
éstos es incompleta, de lo que se deduce que el fenotipo final dependerá tanto del
número de alelos mutantes como del número de alelos silvestres. El triploide, de
genotipo ICU4/ICU4/icu4-1, mostró una apariencia similar a la del heterocigoto
ICU4/icu4-1, lo que es compatible con la hipótesis de que se trata de una mutación de
ganancia de función.
V.2.- El gen ICU4 codifica un producto con función adaxial.
Serrano-Cartagena y colaboradores interpretaron la interacción entre los
alelos icu4-1 y hst-5, ambos pertenecientes a la clase fenotípica Icu, como sinérgica
por el fenotipo extremo del doble mutante, que presentaba una gran curvatura en las
hojas de la roseta basal y un pequeño tamaño (Serrano-Cartagena et al., 2000). Dado
que también se había determinado la existencia de un fenotipo anormal en los frutos
de las plantas homocigotas para los alelos de pérdida de función de HST (SerranoCartagena et al., 2000; Bollman et al., 2003), nos propusimos estudiar si se observaba
asimismo sinergia respecto al fenotipo de los pistilos y los frutos de los dobles
mutantes. Para ello, obtuvimos dobles homocigotos para icu4-1 y el alelo nulo hst-1
(Telfer y Poethig, 1998).
El aspecto de los pistilos del doble icu4-1 hst-1 es llamativo, ya que presentan
una duplicación especular de tejidos adaxiales (placenta con óvulos) en posiciones
abaxiales (replum), así como un desarrollo insuficiente del integumento externo de los
óvulos maduros, que causa un fenotipo similar al que se observa en los individuos
mutados en el gen de naturaleza abaxial INNER NO OUTER (INO; Villanueva et al.,
1999), perteneciente a la familia YABBY. Todo ello nos permitió interpretar que las
mutaciones icu4-1 y hst-1 tenían un efecto sobre la polaridad adaxial-abaxial (véase el
apartado I.6.4), provocando transformaciones adaxiales en los órganos laterales, y que
los productos ICU4 y HST podrían estar, por tanto, participando en el establecimiento
del eje adaxial-abaxial. De acuerdo con esta interpretación, se ha determinado la
función de HST, un gen de gran importancia para la producción de miRNA maduros,
en la regulación de la polaridad de los órganos laterales, comprobándose que la
pérdida de la función del gen da lugar, en efecto, a transformaciones adaxiales
(Bollman et al., 2003; Park et al., 2005).
Fenotipos similares al del doble icu4-1 hst-1, de producción de óvulos
ectópicos, ya se habían descrito en los dobles mutantes para alelos de pérdida de
función en genes miembros de las familias KANADI (KAN1 y KAN2), YABBY (CRC) y
Discusión 107
otros genes como PKL/GMN y HST (Eshed et al., 1999; 2001; Bollman et al., 2003).
Para obtener datos adicionales acerca de la implicación del gen ICU4 en la adquisición
de la polaridad adaxial-abaxial en los órganos laterales, se obtuvieron los dobles
mutantes de icu4-1 con los alelos de pérdida de función kan1-2, pkl-1 y crc-1. Los
dobles mutantes icu4-1 kan1-2 e icu4-1 pkl-1 mostraron un fenotipo meramente
aditivo, mientras que en el doble mutante icu4-1 crc-1 observamos una ligera
intensificación del fenotipo causado por la mutación crc-1. Dado que el gen CRC tiene,
entre otras funciones en los carpelos, la de conferir identidad abaxial a ciertos tejidos,
la interacción observada en el doble icu4-1 crc-1 reforzó nuestra hipótesis acerca de la
función adaxial de la proteína ICU4. Respecto a esta serie de resultados, merece la
pena resaltar que el alelo nulo kan1-2, al igual que ocurre con icu4-1, no interacciona
con pkl-1 y sí lo hace con crc-1 y hst-1 (Eshed et al., 1999; 2001; Bollman et al., 2003),
de modo que una posible interpretación a los resultados obtenidos en estos
cruzamientos sería que la ganancia de función del gen ICU4, debida al alelo icu4-1,
actuara de forma negativa sobre la expresión de algún gen de la familia KANADI,
quizá el propio KAN1. Ello permitiría explicar por qué no se produce interacción entre
icu4-1 y el alelo kan1-2, y sí la hay entre icu4-1 y los alelos crc-1 y hst-1.
Otra prueba adicional sobre la función adaxial de la proteína ICU4 la
constituye la interacción sinérgica entre icu4-1 y fil-3, un alelo débil de FILAMENTOUS
FLOWER (FIL), otro gen de naturaleza abaxial perteneciente a la familia YABBY
(Chen et al., 1999; Sawa et al., 1999a; 1999b). Los alelos fuertes de pérdida de
función presentan largos entrenudos en la inflorescencia, debido a defectos en la
formación de las flores, y órganos florales filamentosos, a causa de una fuerte
adaxialización. El alelo hipomorfo fil-3 causa escasos defectos en la formación de las
flores y una débil adaxialización de los órganos florales. Este fenotipo se ve muy
incrementado en el doble mutante icu4-1 fil-3, el cual presenta ocasionalmente pérdida
de la dominancia apical y, tal y como sucede en los alelos fuertes de FIL, muestra un
número de flores muy reducido, una fuerte adaxialización de los órganos florales y
pedicelos y entrenudos largos. El aumento en la intensidad del fenotipo, producido por
el alelo icu4-1, sobre un alelo que produce transformaciones adaxiales, como fil-3, es
un argumento adicional en apoyo de la hipótesis de que el producto ICU4 especifica la
formación de estructuras adaxiales.
En la superficie abaxial de las hojas de la roseta de los mutantes icu4-1 e
icu4-2, cerca del margen foliar, aparecen unas protuberancias similares a las que se
observan en las plantas transgénicas que sobreexpresan el gen ASYMMETRIC
LEAVES2 (AS2) y en el doble mutante kan1 kan2 (Eshed et al., 2001; Lin et al., 2003).
Este fenotipo se ha interpretado como una conversión incompleta de las células
Discusión 108
epidérmicas abaxiales en adaxiales, lo que resulta en la formación de parches de
células con identidad adaxial adyacentes a células con identidad abaxial. Las
protuberancias podrían representar márgenes ectópicos que se forman entre los
parches de células adaxiales y abaxiales, en relación con un modelo que explica la
expansión lateral de la hoja en función de la yuxtaposición en el margen foliar de un
dominio adaxial y otro abaxial (Waites y Hudson, 1995). Este dato también sugiere que
los alelos icu4-1 e icu4-2 causan transformaciones adaxiales.
V.3.- El gen ICU4 codifica el factor de transcripción ATHB15, perteneciente a la
familia HD-ZIP III.
La polaridad adaxial-abaxial, una propiedad de los órganos laterales de las
plantas, como las hojas y los órganos florales, se admite actualmente que se adquiere
a partir de una señal adaxializante que emana del meristemo apical (Sussex, 1954).
Los dominios adaxial y abaxial de los primordios de los órganos laterales están
definidos por la actividad de los factores adaxializantes, principalmente los factores de
transcripción pertenecientes a la clase III de la familia de genes HD-ZIP (HD-ZIP III), y
por los factores abaxializantes de las familias KANADI y YABBY (Eshed et al., 1999;
Siegfried et al., 1999; Kerstetter et al., 2001; Kumaran et al., 2002; Emery et al., 2003).
La cartografía de baja resolución, llevada a cabo en el laboratorio de J.L.
Micol, permitió acotar la posición del gen ICU4 a una amplia región del cromosoma 1
(Serrano-Cartagena et al., 2000). En esta región se localizaba el gen ATHB15,
también llamado recientemente CORONA (CNA, Green et al., 2005; Prigge et al.,
2005), perteneciente a la familia HD-ZIP III. La familia consta de varios miembros de
los que se ha publicado la existencia de mutaciones semidominantes responsables de
transformaciones adaxiales (McConnell y Barton, 1998; McConell et al., 2001; Emery
et al., 2003; Zhong y Ye, 2004). Por lo tanto, el gen ATHB15 se convirtió en nuestro
principal candidato. Inicialmente, determinamos el ligamiento completo entre el locus
alterado en el mutante icu4-1 y un marcador localizado en el mismo PAC que ATHB15,
lo que sugería que, en efecto, podía ser éste el gen afectado en los mutantes icu4-1 e
icu4-2. La secuenciación del gen en el ecotipo En-2 y en las plantas icu4-1 e icu4-2
nos permitió detectar, en ambas, el mismo tipo de mutación dentro de ATHB15. Al
mismo tiempo, mediante cartografía genética y secuenciación, pudimos descartar la
implicación del gen KAN2, también localizado en el mismo intervalo, en el fenotipo
mutante. Los resultados expuestos apoyan de forma contundente, aunque no
concluyente, que las anomalías observadas en los mutantes icu4-1 e icu4-2 se deben
a la mutación observada en el gen ATHB15
Discusión 109
Para demostrar de un modo definitivo la implicación de ATHB15 en el fenotipo
Icu4, no tendría sentido llevar a cabo un análisis de complementación en los mutantes
con un transgén que contuviera el alelo silvestre, ya que al tratarse icu4-1 e icu4-2 de
alelos de ganancia de función nunca se obtendría el rescate fenotípico. Por el
contrario, el cDNA del alelo icu4-1 fusionado al promotor constitutivo 35S debería
causar fenotipo Icu en un fondo silvestre En-2. Efectivamente, las plantas
transformantes que contenían el transgén para el cDNA mutante presentaron diversos
grados de adaxialización de los órganos laterales. Este resultado demuestra que la
sobreexpresión del alelo mutante da lugar a transformaciones de tipo adaxial y resulta
un apoyo muy fuerte a la hipótesis de que ICU4 es el gen ATHB15. Además, al ser
icu4-1 un alelo de ganancia de función, el resultado supone una demostración
adicional de que el producto ICU4, el factor de transcripción ATHB15, tiene una
función adaxial. No obstante, el fenotipo mostrado por las plantas transgénicas fue
más severo que el de los homocigotos icu4-1 e icu4-2, lo que tiene dos
interpretaciones no excluyentes: a) el promotor 35S causa una transcripción
generalizada de los genes que se encuentran bajo su control, mientras que la
transcripción del gen ICU4 endógeno está sujeta a la actividad de su promotor, por lo
que se halla restringida a órganos y tejidos concretos; b) el promotor del gen ICU4 se
expresa en ciertos tejidos con menor intensidad que la del promotor 35S.
La prueba definitiva de que ICU4 y ATHB15 son el mismo gen fue la
obtención de transformantes icu4-1 que contenían una construcción de interferencia
para ATHB15. La supresión completa del fenotipo mutante en estos transformantes
tan sólo puede explicarse si ICU4 y ATHB15 son el mismo gen, ya que una
construcción diseñada para interferir con los transcritos endógenos del gen ATHB15
es capaz de eliminar el fenotipo alterado debido a un alelo mutante de ganancia de
función en el gen ICU4. El conjunto de los resultados evidencian, de forma inequívoca,
que icu4-1 e icu4-2 son alelos de ganancia de función del gen ICU4/ATHB15/CNA, el
cual codifica un producto con función adaxial.
La recientemente descrita mutación cna-1, inducida por EMS, se ha
identificado en una búsqueda de mutaciones que aumentaban el fenotipo del mutante
clavata1-1 (clv1-1). Se ha interpretado que se trata de un alelo dominante negativo del
gen ATHB15, ya que presenta dominancia incompleta cuando se combina con alelos
fuertes clv. Los individuos homocigotos para la mutación muestran una morfología
silvestre, salvo por un ligero aumento en el tamaño del meristemo apical en estadios
tempranos del desarrollo de la roseta. Además, la mutación afecta a un dominio
carboxilo diferente al alterado en los mutantes icu4-1 e icu4-2 (Green et al., 2005). El
distinto comportamiento genético de éstos y del mutante cna-1 constituye un apoyo
Discusión 110
adicional a que los alelos icu4-1 e icu4-2 no son dominantes negativos, y está de
acuerdo con el hecho de que se trata de alelos de ganancia de función.
V.4.- Una mutación puntual en el sitio de unión del miRNA165/166 causa la
sobreexpresión del gen ICU4.
Todas las mutaciones semidominantes descritas hasta la fecha en los
miembros de la familia HD-ZIP III se sitúan en la región que codifica el dominio START
de sus productos proteicos, un dominio de unión a esteroles y lípidos (Ponting y
Aravind, 1999). Este dato llevó a la especulación de que los fenotipos de ganancia de
función observados podrían deberse a la alteración en la percepción por el dominio
START de un ligando de tipo lipídico, que sería la hipotética señal adaxializante que
emanaba del meristemo apical (McConnell et al., 2001). El descubrimiento en esta
región del gen de una secuencia complementaria a dos miRNA que difieren en un solo
nucleótido, los miRNA165 y miRNA166 (Rhoades et al., 2002), hizo más factible la
explicación de que los fenotipos alterados generados por dichas mutaciones pudieran
deberse a la alteración de un proceso de regulación post-transcripcional de los genes
HD-ZIP III mediado por interferencia con miRNA (Reinhart et al., 2002; Rhoades et al.,
2002; Tang et al., 2003). No obstante, aún no es posible descartar por completo que
haya también una activación de los productos proteicos a través de la unión de un
ligando de naturaleza lipídica al dominio START, hipótesis que ha seguido
contemplándose en algunos modelos de reciente publicación, junto a la regulación por
miRNA (Emery et al., 2003; Fig. I.11).
Los alelos icu4-1 e icu4-2 son portadores de exactamente la misma mutación
puntual, situada en la diana del miRNA165/166, que varios alelos semidominantes de
PHABULOSA (PHB) y PHAVOLUTA (PHV, McConnell et al., 2001). Esta diana del
miRNA165/166 también está mutada en otros alelos de ganancia de función de
miembros de la familia HD-ZIP III, como REVOLUTA (REV) y rld1 (Emery et al., 2003;
Juarez et al., 2004a; Zhong y Ye, 2004). Por tanto, la alteración del proceso de
regulación post-transcripcional, debida al desapareamiento entre el miRNA y el mRNA
de ICU4 provocado por la mutación, nos proporciona una explicación molecular para la
ganancia de función de los alelos icu4-1 e icu4-2. Recientemente, se ha demostrado la
ruptura in vivo de los transcritos del gen ATHB15 mediada por el miRNA166 (Kim et
al., 2005).
En el laboratorio de J.L. Micol, se han llevado a cabo experimentos de RTPCR cuantitativa que han permitido comprobar que la alteración producida por los
alelos de ganancia de función resultaba en una mayor acumulación de transcritos del
Discusión 111
gen ICU4. Todos los tejidos estudiados mostraron mayor cantidad de transcritos en el
mutante icu4-1 que en el silvestre En-2. Además, los órganos que exhibían un fenotipo
más evidente, como las hojas y los tallos, presentaron los mayores incrementos en el
mRNA del gen. Sin poder descartar por completo la existencia de regulación a través
del dominio proteico START, el conjunto de resultados se ajusta a que los alelos icu41 e icu4-2 son semidominantes y de ganancia de función debido a la eliminación, total
o parcial, del mecanismo de regulación post-transcripcional del gen ICU4 mediado por
miRNA. Este comportamiento de los alelos semidominantes permite explicar por qué
los transformantes que sobreexpresan el cDNA mutante, que no está sujeto a la
regulación post-transcripcional, tienen un fenotipo distinto al de los transformantes que
sobreexpresan el cDNA silvestre, cuyo mensajero sí posee una diana activa para los
miRNA.
La formación de hojas curvadas hacia el haz quedaría explicada por la
sobreexpresión del gen en los mutantes, lo que llevaría a una gran acumulación del
producto ICU4, de naturaleza adaxial, que causaría la curvatura. El fenotipo producido
por los alelos icu4-1 e icu4-2 es termosensible, siendo más acusado a 25ºC que a
20ºC, tal y como sucede con el alelo semidominante phb-1d (McConnell y Barton,
1998), y muy pleiotrópico, ya que afecta no sólo al establecimiento del eje adaxialabaxial, sino también al cambio de fase, a la filotaxia, al patrón radial de los tallos y a
la embriogénesis.
V.5.- Los alelos de pérdida de función de ICU4 no muestran fenotipo mutante.
Hemos identificado dos alelos de pérdida de función del gen ICU4, portadores
de inserciones de T-DNA, ninguno de los cuales causa fenotipo mutante en
homocigosis. Esto, tal y como se ha publicado recientemente, puede ser atribuible a la
redundancia funcional existente entre los miembros de la familia HD-ZIP III (Emery et
al., 2003; Prigge et al., 2005). En consonancia con este dato, ninguna de las líneas En2 transgénicas portadoras de la construcción de interferencia y, por tanto, susceptibles
de carecer de la función del gen ICU4 presentó fenotipo mutante. Estos resultados
están de acuerdo con la ausencia de fenotipo alterado en las plantas homocigotas
para el alelo nulo cna-2, que contiene una inserción de T-DNA en el gen ATHB15
(Prigge et al., 2005). Nuestros resultados y los de Prigge y colaboradores (2005)
entran en franca contradicción con los de Kim y colaboradores (2005), que
recientemente han publicado fenotipos mutantes muy severos, incluyendo la letalidad
en algunas líneas, causados por una construcción antisentido del gen ATHB15.
Discusión 112
Aunque ATHB8 es el parálogo más cercano a ICU4, los dobles mutantes para
alelos de pérdida de función de ambos genes tampoco muestran ninguna alteración en
su fenotipo. Este resultado, que también está de acuerdo con lo publicado por Prigge y
colaboradores (2005), sugiere que ICU4 podría ser redundante con genes que no
pertenecen a su clado, independientemente de que lo sea o no con el propio ATHB8.
Los fenotipos de dobles, triples y cuádruples mutantes afectados en diversos genes
HD-ZIP III indican que ICU4 presenta redundancia funcional con PHB, PHV y REV
durante la embriogénesis, de manera que diversos mutantes múltiples carecen de
meristemo apical, y que hay redundancia de ICU4, PHB y PHV en la homeostasis del
meristemo apical, ya que triples mutantes que carecen de la función de los tres genes
presentan un meristemo apical de gran tamaño, tallos fasciados y anomalías en los
haces vasculares (Prigge et al., 2005). Sorprendentemente, los genes ICU4 y ATHB8
mostraron escasa redundancia funcional en estos experimentos, con la salvedad de la
supresión de ciertos fenotipos causados por la ausencia de la función de REV cuando
se añadían mutaciones de pérdida de función para los dos genes (Prigge et al., 2005).
En todo caso, estos experimentos aportan la visión de un comportamiento complejo de
los genes HD-ZIP III, tal que, dependiendo del órgano en estudio, se observan
relaciones de sinergia o de antagonismo entre ellos (Prigge et al., 2005).
V.6.- ICU4 participa en la formación del patrón radial del tallo.
V.6.1.- ICU4 promueve la diferenciación de los tejidos vasculares.
Nuestros resultados indican que el gen ICU4 promueve el desarrollo vascular,
fundamentalmente a través de la estimulación de la proliferación de las células del
procámbium. Este dato coincide con un trabajo realizado sobre el gen de Arabidopsis y
su ortólogo en Zinnia elegans, ZeHB-13, en el que se demostraba que los dos se
expresan en las células del procámbium, y se sugería que desempeñan una función
en la diferenciación o el mantenimiento de estas células (Ohashi-Ito y Fukuda, 2003).
También se han publicado argumentaciones completamente contradictorias con la
anterior, sugiriéndose que su papel sería el de regular negativamente la producción de
los tejidos vasculares, de tal forma que el gen estaría implicado en el mantenimiento
del estado indiferenciado de las células del procámbium (Kim et al., 2005). Sin
embargo, como esta hipótesis surge de la interpretación del fenotipo de las plantas
transgénicas para una construcción antisentido del gen (véase el apartado V.5; Kim et
al., 2005), cuyo aspecto debe depender de factores adicionales a la mera ausencia de
Discusión 113
la función de ICU4, consideramos que el conjunto de datos a favor de nuestra
hipótesis es más contundente.
La sobreexpresión del gen en el mutante icu4-1 causa que éste produzca más
del doble de procámbium que el silvestre y, en consecuencia, que presente más
floema y xilema. Por lo tanto, el área total de los haces vasculares en las secciones de
los tallos es claramente mayor en el mutante, en apoyo de que ICU4 promueve el
desarrollo vascular. No obstante, la cuantificación precisa de un elemento de patrón,
como es en este caso la cantidad de haz vascular por sección de tallo, debería ser
referida al área o volumen del campo de desarrollo en el que dicho elemento de patrón
se ha diferenciado. Por ello, obtuvimos la media de la superficie total de haces
vasculares por tallo en relación con la media de las áreas de los tallos, encontrando
que este valor es un 25% mayor en el mutante, lo que demuestra que éste produce
más tejido vascular que el silvestre. Como los homocigotos icu4-1 presentan las
alteraciones en el patrón vascular con penetrancia incompleta, probablemente debido
a la termosensibilidad del alelo mutante, se observa que las diferencias en la
producción de tejido vascular entre el mutante y el silvestre son incluso mayores
cuando sólo se tienen en cuenta los tallos de icu4-1 con seis o menos haces
vasculares.
V.6.2.- ICU4 participa en la formación del patrón en la eustela.
La mayoría de los cortes histológicos realizados en las inflorescencias
principales de las plantas del ecotipo En-2 presentaron una eustela con 8 haces
vasculares, un número muy común también en otros ecotipos (Ye, 2002; Kang et al.,
2003). Este número se redujo a 5 o 6 en algunas inflorescencias del mutante icu4-1,
un fenotipo que apareció con una baja penetrancia, de alrededor del 20%. A pesar de
la penetrancia incompleta, varios argumentos apoyan que se trata, en efecto, de una
alteración en el número de un elemento de patrón en el tallo: a) Las inflorescencias de
En-2 nunca muestran menos de 7 haces vasculares; b) el fenotipo se observa
siempre, e incluso aumenta en diversas combinaciones dobles mutantes que incluyen
el alelo icu4-1, como por ejemplo, en las plantas icu4-1 fil-3 e icu4-1 pny-40126, y c) la
reducción en el número de haces vasculares tras tratamiento con la hormona sintética
NAA es mayor en el mutante que en el silvestre.
Se observa un incremento en el número de haces vasculares en los mutantes
que poseen meristemos grandes y tallos muy gruesos, tal y como ocurre en los
mutantes clv (Turner y Sieburth, 2002; Green et al., 2005). Así mismo, un meristemo
de pequeño tamaño y/o un tallo muy fino podrían ser la causa de que hubiera una
reducción en el número de haces vasculares, como sucede en el mutante vein
Discusión 114
patterning1 (vep1), que muestra una disminución tanto del número de haces como del
área del tallo (Jun et al., 2002). Sin embargo, las variaciones en el número de haces
vasculares en los tallos de icu4-1 no parecen deberse a una disminución en el grosor
de los tallos, ya que los valores medios para las áreas de los tallos de las plantas
mutantes y En-2 son muy similares. Esto sugiere que el fenotipo de icu4-1 no es una
mera consecuencia de la reducción en el número de células meristemáticas
fundadoras, sino un defecto de formación de patrón que afecta específicamente a la
producción o al mantenimiento de los haces vasculares.
Teniendo en cuenta que el tratamiento de las plantas con inhibidores del
transporte polar de auxinas da lugar a tallos con más tejidos vasculares (Mattson et al.,
1999) y que los mutantes auxin resistant1 (axr1), con una respuesta reducida a
auxinas, tienen un número incrementado de haces con células pobremente
diferenciadas (Lincoln et al., 1990), una posible hipótesis para explicar la formación de
un bajo número de haces vasculares muy gruesos en icu4-1 podría ser que el mutante
tuviera aumentada alguna de las vías implicadas en la señalización por auxina, ya
fuera la percepción o su flujo polar. De hecho, una de las observaciones realizadas en
el laboratorio de J.L. Micol ha sido que el mutante icu4-1 sobreexpresa en algo más de
5 veces el gen PINOID (PID), que codifica una quinasa de serina/treonina implicada en
la regulación positiva del flujo polar de auxina (Christensen et al., 2000; Benjamins et
al., 2001). Además, el mutante polycotyledon de tomate, que presenta un aumento en
el flujo polar de auxina, comparte muchos fenotipos con el mutante icu4-1, como la
variación en el número de cotiledones, la disminución de la fertilidad de los estambres,
el retraso en el tiempo de floración o la formación de un número algo reducido de
haces vasculares muy gruesos en los hipocotilos (Al-Hammadi et al., 2003).
Resulta, por tanto, factible que algunos de los fenotipos que observamos en el
mutante icu4-1 puedan deberse a un aumento del flujo polar de auxina. Así, dado que,
según la hipótesis de la canalización, los haces vasculares se inducen a lo largo de las
vías principales de flujo de auxina (Sachs, 1981; 1991), la formación de haces
vasculares gruesos en el mutante icu4-1 daría lugar a una tasa de flujo muy elevada
en cada uno de los haces. Esto produciría la rápida eliminación de las auxinas en los
tejidos circundantes a cada haz en formación, que los incapacitaría para dar lugar a la
producción de más haces vasculares, lo que resultaría en una disminución de su
número. De manera alternativa, si hubiera un mecanismo de inhibición lateral
mediante el que un haz en formación impidiera la inducción de haces vasculares
adicionales en su proximidad, como sugiere la existencia del mutante continuous
vascular ring1 (cov1, Parker et al., 2003), los gruesos haces vasculares de icu4-1
Discusión 115
podrían estar produciendo una señal inhibidora más fuerte que diera lugar a una
disminución en el número de los haces.
V.6.3.- ICU4 participa en la formación del patrón interno de los haces vasculares.
Algunas publicaciones recientes han mostrado la relación entre el eje centralperiférico de los órganos con simetría radial, como los tallos, y el eje adaxial-abaxial de
los órganos laterales. Ambos ejes se estarían estableciendo mediante un mecanismo
común que actuaría en los órganos que derivan tanto del meristemo apical como de
los meristemos vasculares (Tasaka, 2001; Emery et al., 2003). Los alelos mutantes de
ganancia de función en los genes HD-ZIP III descritos hasta el momento dan lugar a
un fenotipo considerado de pérdida de polaridad en los haces vasculares. Éstos, en
las estirpes silvestres de Arabidopsis, tienen un patrón colateral, es decir, hay una
zona del haz con xilema y, en paralelo a ésta y separada de ella por procámbium, otra
región con floema. Así, en las hojas, el xilema ocupa una posición adaxial y el floema
una posición abaxial, mientras que en los tallos, el xilema se sitúa hacia el centro y el
floema hacia la periferia (véase el apartado I.6.3.1.1; Ye et al., 2002). El alelo
semidominante phb-1d produce, en ocasiones, la transformación en las hojas
radializadas (adaxializadas) del patrón colateral en otro anfivasal (McConnell y Barton,
1998), esto es, el floema ocupa una posición central en el haz y está rodeado por
xilema (véase el apartado I.6.3.1.1; Ye et al., 2002). Aunque este fenotipo no se ha
podido observar en los tallos, debido a que las plantas homocigotas para phb-1d no
llegan a producir la transición floral, hemos podido comprobar que las plantas
heterocigotas para este alelo dan lugar a algunos haces vasculares con un patrón
parcialmente anfivasal. La formación de haces anfivasales es más acusada, tanto en
las hojas como en los tallos, en las plantas portadoras de alelos semidominantes del
gen REV (Zhong et al., 1999; Emery et al., 2003; Zhong y Ye, 2004). Consistente con
estos resultados, la pérdida de función de tres genes de la familia KANADI, en el triple
mutante kan1-2 kan2-1 kan3-1, también determina la formación de haces vasculares
anfivasales (Emery et al., 2003). Por lo tanto, al igual que ocurre con la polaridad
adaxial-abaxial de los órganos laterales, la polaridad colateral de los haces parece
estar definida por las actividades antagónicas de los genes HD-ZIP III y los genes
KANADI.
El alelo icu4-1, a diferencia de los anteriores, nunca da lugar a haces
vasculares anfivasales, ni en heterocigosis ni en homocigosis. No obstante, las plantas
transgénicas que sobeexpresan el cDNA mutante icu4-1, cuando florecen, producen
tallos que contienen haces con un patrón anfivasal bastante acusado. Es decir, estas
plantas no sólo pueden presentar órganos laterales muy adaxializados, sino que
Discusión 116
también muestran la radialización parcial de los haces vasculares. El resultado indica
que el producto ICU4 posee función tanto para la especificación de la identidad adaxial
en los órganos laterales, como para la especificación del eje central-periférico en los
haces vasculares. Una corroboración adicional de esta interpretación la constituye el
fenotipo sinérgico observado en los haces del doble heterocigoto para los alelos icu4-1
y phb-1d, con un patrón claramente anfivasal, que indica que el gen ICU4, tal y como
se ha interpretado para PHB y REV, estaría participando en el establecimiento del
patrón de tejidos en los haces vasculares (Emery et al., 2003; Dinneny y Yanofsky,
2004; Zhong y Ye, 2004).
Un resultado interesante a tener en cuenta es que las plantas transgénicas
que sobreexpresan el cDNA silvestre de ICU4, aunque presentan un mayor número de
haces vasculares, posiblemente debido al gran grosor de sus tallos, aquéllos siguen
manteniendo el patrón colateral. Puesto que las características del promotor empleado
y de las construcciones realizadas son idénticas en los dos tipos de plantas
transgénicas, con la salvedad de que unas sobreexpresan el cDNA silvestre y otras el
mutante, la diferencia de patrón vascular debe estar causada por la alteración en el
mecanismo de regulación por miRNA. Estos resultados sugieren que hay un
mecanismo de información posicional, mediado por la regulación de los miRNA sobre
los genes HD-ZIP III, que está implicado en el establecimiento del patrón colateral
característico de los haces vasculares de Arabidopsis (Emery et al., 2003; Zhong y Ye,
2004).
V.6.4.- La participación de ICU4 en la formación del patrón radial del tallo incluye
también a tejidos no vasculares.
La intervención de los genes HD-ZIP III en el establecimiento del patrón radial
del tallo se ha limitado, hasta el momento, a su función sobre el patrón y la posición de
los haces vasculares (Emery et al., 2003; Dinneny y Yanofsky, 2004; Zhong y Ye,
2004), no habiéndose descrito alteración alguna de otros tipos celulares, ni en los
mutantes simples ni en los dobles mutantes, con la salvedad de las fibras
interfasciculares en las plantas rev. En un apartado anterior, se ha comentado el
fenotipo sinérgico de los dobles mutantes icu4-1 hst-1, que producen fuertes
transformaciones adaxiales en estructuras de naturaleza abaxial (véase el apartado
V.2). Cuando observamos cortes histológicos transversales de los tallos de estos
dobles
mutantes,
comprobamos
que
el
patrón
radial
estaba
fuertemente
desorganizado. Los haces vasculares habían disminuido extraordinariamente en su
número y no se organizaban claramente en un anillo o eustela, sino que se
encontraban inmersos entre las células parenquimatosas de la médula, y además,
Discusión 117
mostraban un patrón completamente anfivasal. Por otro lado, no sólo estaban
afectados los haces vasculares, sino también otras capas celulares de las que forman
el patrón radial del tallo. Así, la endodermis desaparecía, y disminuía el número de
capas celulares en la corteza, que presentaba algunas células grandes, de tamaño
similar a las de la médula.
La alteración de este patrón radial fue todavía más severa en las plantas
homocigotas para el alelo hst-1 y heterocigotas para phb-1d. En éstas, algunos haces
vasculares mostraron un patrón anfivasal, mientras que otros estaban completamente
desorganizados, no siendo posible reconocer ningún patrón obvio de disposición del
floema y el xilema. Los haces, además, ocupaban una posición central en el tallo,
desplazando a la médula hacia una situación periférica. No se formaron fibras
interfasciculares, también desaparecía la endodermis, y las células de la epidermis y
de la corteza adquirieron un gran tamaño. De hecho, el patrón de estas dos capas
celulares presentaba un gran parecido con las capas de epidermis y de parénquima en
empalizada características de la superficie adaxial de las hojas y los cotiledones. Dado
que, según la teoría del teloma, las hojas han evolucionado a partir de los tallos
(Zimmerman, 1952), podría especularse con que en este paso evolutivo hubieran
podido estar implicadas determinadas variaciones en los patrones de expresión de los
genes HD-ZIP III.
En cualquier caso, para explicar los cambios del patrón radial observados en los
tallos anteriores, hay que tener en cuenta el efecto muy pleotrópico de la mutación hst1 (Bollman et al., 2003), que estaría afectando a la expresión no sólo de los genes HDZIP III, sino también a la de otros muchos genes regulados por miRNA, como ocurre,
por ejemplo, con el gen SCARECROW (SCR), que está implicado en la formación del
patrón radial en la raíz y el tallo (Wysocka-Diller et al., 2000). No obstante, los
fenotipos descritos tan sólo se observan cuando se combina el alelo hst-1 con
mutaciones de ganancia de función en los genes HD-ZIP III, como icu4-1 y phb-1d, lo
cual indica que estos genes deben estar actuando en la regulación de todos, o la gran
mayoría, de los elementos que componen el patrón radial del tallo, y no sólo en la
formación del patrón en los haces vasculares. Además, dado que, entre los genes
regulados por miRNA, los HD-ZIP III son los únicos de los que se ha descrito su
implicación en el patrón colateral de los haces, creemos bastante probable que los
cambios observados hacia una organización anfivasal o a la desorganización completa
del haz se deban a una desrepresión generalizada de genes HD-ZIP III en el fondo
hst-1, además de la propia desregulación producida por la mutación icu4-1 o la phb1d.
Discusión 118
En resumen, la alteración general del patrón radial del tallo causada por la
combinación de las mutaciones semidominantes icu4-1 o phb-1d con el alelo hst-1
indica que se requiere un control preciso de la expresión de los genes de la familia
HD-ZIP III, no sólo para la correcta localización de los haces vasculares en la eustela y
la formación de un patrón colateral en éstos, sino también para la organización del
resto de los elementos que componen el patrón radial de los tallos. Esta interpretación,
junto al fenotipo de transformación anfivasal observado en los dobles heterocigotos
icu4-1 phb-1d, sugiere que los patrones de expresión de los distintos genes HD-ZIP III
y la localización precisa de sus productos proteicos confieren información posicional
en los tallos, necesaria para establecer el patrón correcto de tejidos dentro de los
haces vasculares y el conjunto del patrón radial de los tallos.
V.6.5.- Relación entre el flujo polar de auxinas y la función del gen ICU4 en la
formación del patrón radial del tallo.
Diferentes ensayos fisiológicos han puesto de manifiesto la importancia de las
auxinas en la diferenciación del tejido vascular (Jacobs, 1952; Young, 1953; Aloni,
1987). De hecho, las auxinas tienen una función determinante no sólo en la
diferenciación de las células vasculares, sino también en la producción de haces
vasculares continuos que, finalmente, acabarán organizándose en un patrón definido
(Sachs, 1981; 1991; Berleth et al., 2000). Además, la alteración del proceso de
señalización de las auxinas, como ocurre cuando se inhibe el flujo polar de auxina,
afecta severamente a la diferenciación del tejido vascular y a la formación del patrón
correcto (Mattson et al., 1999; 2003). Para verificar una posible interacción entre ICU4
y la vía de señalización de las auxinas en la formación del patrón radial del tallo,
llevamos a cabo tratamientos con un inhibidor del transporte polar, el NPA, y con una
auxina sintética, el NAA, tanto en las plantas mutantes como en las silvestres.
Los tratamientos con NPA en las plantas En-2 producen el fenotipo descrito
previamente para otros ecotipos (Gälweiler et al., 1998; Mattson et al., 1999),
consistente en una gran proliferación del tejido vascular, que prácticamente forma un
anillo continuo. Este resultado está de acuerdo con la hipótesis de la canalización de
Sachs (1981; 1991; véase el apartado I.6.3.1.2), que afirma que la diferenciación
vascular ocurre a lo largo de las rutas de flujo preferencial de auxina, formadas al
aumentar la conductividad para esta hormona vegetal en las células que la
transportan, mediante un flujo de retroalimentación positiva. La gran amplitud de las
zonas en las que se diferencia el tejido vascular en las plantas tratadas con NPA se
debe a que, al disminuir el flujo polar, la auxina se acumula y se transporta
lateralmente. Sorprendentemente, cuando se trataron las plantas icu4-1 con NPA,
Discusión 119
además de la proliferación de tejido vascular observada en el silvestre, muchos de los
haces vasculares mostraron un patrón anfivasal y se situaron más internamente en el
tallo, un fenotipo que guarda una cierta similitud al causado por avb1, un alelo de
ganancia de función de REV (Zhong et al., 1999; Zhong y Ye, 2004). Este resultado
indica una participación de la auxina tanto en la formación de los haces vasculares
como en el patrón que éstos adoptan, procesos en los que también participan los
genes HD-ZIP III.
Los tratamientos con NAA en las plantas silvestres produjeron fenocopias del
patrón vascular observado en los mutantes icu4-1, de manera que aquéllas mostraron
un menor número de haces vasculares de mayor tamaño, mientras que el mismo
tratamiento en las plantas icu4-1 acentuó aún más el fenotipo mutante. Una posible
explicación para este resultado sería que, al incrementar la concentración de auxina,
se produciría un incremento en la capacidad de las células para su transporte polar,
como dicta la hipótesis de la canalización de Sachs (1981; 1991; véase el apartado
I.6.3.1.2). Como resultado, acabarían formándose unos haces vasculares de gran
tamaño que inhibirían la formación de otros haces en sus inmediaciones. En este
contexto, consideramos poco probable la existencia de un fenómeno de inhibición
lateral debido a la eliminación de las auxinas en los tejidos circundantes al haz
vascular en formación, ya que en las plantas tratadas con NAA debe haber un exceso
de auxina. Por ello, además de la canalización, nuestros resultados apoyan la
existencia de un proceso de inhibición lateral activo debido a una sustancia inhibidora,
aún por descubrir, tal y como propone la hipótesis de la difusión-reacción (véase el
apartado I.6.3.1.2; Koch y Meinhardt, 1994), que está apoyada por diversos resultados
experimentales (Koizumi et al., 2000; Parker et al., 2003). De hecho, no existe una
gran contradicción entre la hipótesis de la canalización y la de difusión-reacción. Esta
última es una hipótesis general para explicar la formación de patrones en numerosos
modelos tanto animales como vegetales, siendo uno de éstos el patrón vascular de las
plantas. La hipótesis de difusión-reacción puede asumir sin problemas el transporte
polar de auxinas, como parte del proceso autocatalítico de una sustancia inductora, así
como la existencia de una sustancia inhibidora o un proceso de inhibición causado por
la simple eliminación de la sustancia inductora de los tejidos cercanos (Meinhardt,
1982; Meinhardt y Gierer, 2000).
Los resultados discutidos en este apartado indican que los fenotipos de los
tallos del silvestre y de icu4-1 dependen de la señal de auxina, y sugieren la existencia
de una colaboración entre las auxinas y los genes pertenecientes a la familia HD-ZIP
III para el establecimiento del patrón radial del tallo. Quedaría aún por responder la
pregunta de cómo se produciría dicha colaboración. Una posibilidad sería que la
Discusión 120
expresión de los genes HD-ZIP III estuviera regulada por auxina. Sin embargo, el
único gen de la familia que incrementa rápidamente su transcripción en respuesta a
esta fitohormona es ATHB8 (Baima et al., 1995; Mattson et al., 2003; Kim et al., 2005).
Esto no descartaría una posible regulación de los miRNA165/166 por auxina, los
cuales, a su vez, actuarían sobre la expresión de los genes HD-ZIP III. No obstante, al
menos el miRNA166a tampoco parece responder a tratamientos con auxina (Kim et
al., 2005).
Otra alternativa sería que los patrones de expresión de los genes HD-ZIP III,
quizá con la excepción de ATHB8, no fueran dependientes de auxina, sino que sus
productos estuvieran modulando de algún modo la vía de señalización de esta
hormona vegetal. En este sentido, conviene resaltar la sobreexpresión que se produce
del gen PID en el mutante icu4-1 (véase el apartado V.7), que indica que ICU4 estaría
regulando positivamente la expresión de dicho gen, y la gran reducción en la
transcripción de los genes que codifican los transportadores de auxina PIN3 y PIN4 en
los mutantes carentes de la función de REV, los cuales presentan también una severa
reducción del flujo polar de auxina (Zhong y Ye, 2001). Además, cuando se analiza el
patrón de expresión de ICU4 en los tallos, se observa que el mRNA del gen se detecta
por toda la zona del meristemo que va a dar lugar al procámbium. Inmediatamente por
debajo del meristemo, el gen se expresa con intensidad en los grupos de células que
van a formar parte de los haces y algo menos por toda la médula; y en zonas inferiores
del tallo, tan sólo se detectan sus transcritos en los haces vasculares. Con ligeras
diferencias, que radican en si se expresan o no en la médula y la intensidad con la que
lo hacen en el meristemo, los patrones de expresión de los demás genes HD-ZIP III en
los tallos son relativamente similares (Prigge et al., 2005).
Basándonos, en todo este conjunto de resultados, que abarca los fenotipos
con los tratamientos con NPA y NAA, la expresión independiente de auxina de la
mayoría de los genes HD-ZIP III, la posible regulación positiva de genes que participan
en el transporte polar de auxinas por parte de los genes HD-ZIP III y los patrones de
expresión de éstos, proponemos una hipótesis en la que los productos HD-ZIP III, y
posiblemente los productos de genes de naturaleza abaxial, que actuarían de forma
antagónica, estarían formando un prepatrón sobre el cual se canalizaría el flujo polar
de auxinas, de manera que la formación de un haz vascular y la intensidad del flujo a
través de él dependería de la concentración de auxina, que estaría actuando como
morfógeno, y de los productos HD-ZIP III, que determinarían la respuesta final de las
células. Por tanto, según esta hipótesis, el patrón radial del tallo y la organización
interna de los haces vasculares dependería tanto de las auxinas como de la
información posicional conferida por los productos HD-ZIP III, que modularían
Discusión 121
determinados aspectos de la vía de señalización de auxinas, como la capacidad del
tejido para el transporte polar de esta hormona vegetal.
Los haces vasculares anfivasales dispuestos en una atactostela, es decir, los
haces vasculares que están dispersos por el tallo y no forman un anillo o eustela, son
característicos de muchas especies de monocotiledóneas, mientras que los haces
colaterales organizados en una eustela son más comunes en las dicotiledóneas (Ye,
2002). Se cree que la atactostela con haces anfivasales ha surgido evolutivamente a
partir de la eustela con haces colaterales (Mauseth, 1988), y se ha sugerido que en
dicha evolución podrían haber estado implicados los genes HD-ZIP III, mediante
mutaciones de ganancia de función (Zhong y Ye, 2004). Sin embargo, no se han
encontrado aún monocotiledóneas cuyas estirpes silvestres presenten genes HD-ZIP
III con alelos semidominantes; y, además, cabría esperar que muchas mutaciones de
este tipo dieran lugar a alteraciones tan graves que no les permitieran prosperar en
condiciones naturales. Nuestro trabajo permite contemplar otro escenario en el que
cambios sutiles en la función de los promotores de los genes HD-ZIP III, en la
expresión de los miRNA que regulan post-transcripcionalmente a los genes HD-ZIP III
y/o en la señal de auxinas podrían ser los responsables de la formación de haces
anfivasales con un patrón en atactostela, sin que por ello se produjeran plantas
gravemente afectadas.
V.7.- Relaciones sinérgicas y antagónicas entre diferentes alelos mutantes de
miembros de la familia HD-ZIP III.
Las fuertes transformaciones adaxiales que sufren los órganos laterales de
los individuos heterocigotos para el alelo de ganancia de función phb-1d se reducen en
presencia de una copia del alelo mutante icu4-1, de forma que el doble heterocigoto
ICU4/icu4-1;PHB/phb-1d muestra un fenotipo menos adaxializado que el del
heterocigoto PHB/phb-1d. Este resultado indica que icu4-1 suprime parcialmente el
fenotipo causado por phb-1d, lo que sugiere la existencia de antagonismo entre
ambos. A su vez, como estos dos alelos son de ganancia de función, el resultado
también sugiere que podría haber una relación antagónica entre los genes ICU4 y
PHB en la determinación del eje adaxial-abaxial de los órganos laterales. Sin embargo,
cuando se observó el patrón radial de los tallos de los dobles heterocigotos, se pudo
comprobar que el fenotipo incrementaba con respecto a los dos heterocigotos
sencillos, en una interacción que puede calificarse como sinérgica. Por lo tanto, de
este resultado, se desprende una conclusión contraria a la anterior para el eje adaxial-
Discusión 122
abaxial. Los genes ICU4 y PHB estarían colaborando en la determinación del patrón
en los haces vasculares.
Podría encontrarse una solución a esta aparente paradoja mediante el estudio
de los patrones de expresión de los dos genes. Mientras que el mRNA de PHB se
detecta en el tallo y en las regiones adaxiales de las hojas, ICU4 se expresa en el tallo
y no lo hace adaxialmente en los órganos foliares (véase la sección IV.4.3; McConnell
et al., 2001; Prigge et al., 2005). Por lo tanto, hay antagonismo en los órganos en los
que sólo se expresa PHB y sinergia en un órgano donde se expresan los dos genes.
Esto implicaría que las dianas de estos genes en los órganos laterales y en los tallos
son diferentes o que debe haber factores moduladores de la respuesta a la acción de
los genes en los distintos órganos. Es decir, a pesar de que se ha propuesto la
existencia de un mecanismo común en el establecimiento del eje adaxial-abaxial de
los órganos laterales y en la formación del patrón radial de los tallos, este resultado
plantea la existencia de algunas diferencias en ambos procesos.
¿Cómo se produciría el antagonismo o la sinergia entre los dos genes? Las
transformaciones adaxiales producidas por phb-1d se deben fundamentalmente a la
expresión ectópica del gen en la región abaxial. Por lo tanto, la disminución del
fenotipo mutante en los dobles heterocigotos implica que el producto ICU4 también
debe estar presente en las regiones abaxiales, con dos posibles interpretaciones: a)
ICU4 se une a las dianas de PHB, lo que impediría la función de este producto; b) el
secuestro de PHB por parte de la proteína ICU4, al formarse heterodímeros ICU4PHB. Nosotros nos decantamos por esta última alternativa, ya que hemos visto
anteriormente que el producto ICU4 especifica identidad adaxial (véase el apartado
V.2), de forma que la unión de ICU4 a dianas concretas en el DNA debería dar lugar a
transformaciones adaxiales. Además, la segunda opción es consistente con la
formación de homo y heterodímeros recientemente publicada entre los miembros de la
familia HD-ZIP III de Zinnia elegans, ZeHB-10, ZeHB-11 y ZeHB-12 (Oashi-Ito et al.,
2002), y con el comportamiento de cna-1, un alelo parcialmente antimorfo de ICU4,
que interfiere con la función del alelo silvestre y con la de otros genes HD-ZIP III
(Green et al., 2005).
A través del estudio de mutantes múltiples para alelos de pérdida de función
en los genes HD-ZIP III, se ha podido determinar la existencia de sinergia y
antagonismo entre ICU4 y PHB dependiendo del órgano en estudio (Prigge et al.,
2005). Nuestro resultado aporta una información adicional a este trabajo. Los
heterodímeros ICU4-PHB no deberían tener actividad, o una actividad escasa, en la
especificación del eje adaxial-abaxial y sí deberían tenerla en la especificación del
patrón de los haces vasculares en el tallo. Esto, unido a los patrones de expresión de
Discusión 123
los dos genes, parece indicar que ICU4 no tiene una función directa en la
determinación del eje adaxial-abaxial de los órganos laterales y sí la tiene en la
especificación del patrón radial en el tallo. En apoyo de esta hipótesis, las hojas de los
mutantes icu4-1 e icu4-2 presentan alteraciones en el tamaño de las células tanto en
su superficie abaxial como en la adaxial (véase el apartado IV.1.1; J.L. Micol,
comunicación personal), de lo que se desprende que no sólo está afectado el dominio
abaxial, sino también el adaxial, y que, en los mutantes, el producto ICU4 está
interfiriendo con el desarrollo normal de este dominio.
Los individuos homocigotos para los alelos de pérdida de función del gen
REV carecen de meristemos axilares y de fibras interfasciculares, y muestran una
reducción en el número de flores fértiles (Talbert et al., 1995; Zhong y Ye, 1999;
Otsuga et al., 2001). Recientemente, se ha publicado que estos fenotipos se suprimen
parcialmente en un triple mutante para los alelos de pérdida de función cna-2 (un alelo
nulo de ICU4), athb8-11 y rev-6, lo que se interpretó como una prueba de antagonismo
entre las funciones de REV y las de los genes ICU4 y ATHB8. Los productos de ICU4
y ATHB8 se estarían uniendo a las dianas de REV y, posiblemente, de PHB y PHV,
impidiendo la acción de estos factores de transcripción (Prigge et al., 2005).
Sorprendentemente, nuestros resultados demuestran que el fenotipo Rev también se
suprime parcialmente en los dobles mutantes icu4-1 rev-1 e icu4-1 rev-6. Por lo tanto,
la sobreexpresión del gen ICU4, que tiene lugar en el mutante icu4-1, es capaz de
compensar la deficiencia de la función REV, lo que descarta la hipótesis que se había
propuesto de competencia por las dianas para explicar la relación antagónica.
Una posible interpretación para estas interacciones antagónicas y sinérgicas
guarda relación con la demostración de que muchos de los fenotipos causados por la
homocigosis de los alelos rev se deben a la reducción del transporte polar de auxina,
originada por la disminución de los niveles de dos transportadores de esta
fitohormona, PIN3 y PIN4 (Zhong y Ye, 2001). Es, por tanto, posible que, dado que
PID se sobreexpresa en el mutante icu4-1, ello pudiera compensar la reducción en el
transporte en los mutantes rev, lo que permitiría explicar la supresión del fenotipo
mutante. No obstante, todavía quedaría por explicar por qué también la eliminación de
ICU4 y ATHB8 da lugar a la recuperación del fenotipo silvestre (Prigge et al., 2005).
Una posible hipótesis estaría relacionada con la complejidad de las respuestas a la
señal de auxina, dado que ésta puede producir la activación o la inhibición de
determinados procesos dependiendo de su concentración y de interacciones con otras
hormonas vegetales, tal y como ocurre con la elongación celular en los tallos y
coleoptilos, que se induce a concentraciones bajas de auxinas y se inhibe a
concentraciones elevadas (Eckardt, 2005).
Discusión 124
Una hipótesis alternativa, pero no excluyente con la anterior, sería la
formación de diferentes combinaciones de homo o heterodímeros en los distintos
mutantes. De hecho, el conjunto de los datos sugiere que el sistema de los genes HDZIP III ha evolucionado hacia un modelo en el que las funciones precisas son
aportadas por el establecimiento de los dominios de acción de sus productos,
coincidentes en unos casos y excluyentes en otros. Así, en la gran mayoría de las
regiones en las que se están expresando varios genes HD-ZIP III, éstos están
actuando de forma redundante, mientras que un gen expresado ectópicamente altera
la información posicional, lo que provoca un fenotipo mutante, pudiendo incluso
interferir con la función de otros genes de la familia. Esto explicaría por qué el sistema
es más resistente a la pérdida de función en los genes que a su ganancia.
V.8.- ICU4 participa en la formación del patrón de filotaxia e interacciona con
genes implicados en dicho proceso.
El desarrollo vegetativo de las plantas comprende dos fases, la juvenil, en la
que se forman hojas pequeñas, con filotaxia decusada (ángulo de divergencia entre
hojas consecutivas de 180°) y que carecen de tricomas en la superficie abaxial, y la
adulta, en la que la filotaxia adopta una forma espiral con un ángulo de divergencia
entre órganos sucesivos de unos 137,5° y comienzan a aparecer tricomas en la
superficie abaxial de las hojas (véase el apartado I.5). En el ecotipo En-2, los dos
primeros pares de hojas muestran las características típicas de las formadas durante
la fase juvenil, y es aproximadamente a partir de la quinta hoja cuando la filotaxia
comienza a ser espiral y empiezan a reconocerse tricomas en la superficie abaxial. Sin
embargo, en los mutantes icu4-1 e icu4-2, la filotaxia espiral y los tricomas en la
superficie abaxial de las hojas no aparecen hasta el cuarto o quinto par de hojas. Es
más, en ocasiones, incluso en el tallo principal se observan dos hojas caulinares, con
sus inflorescencias axilares asociadas, surgiendo del mismo nudo con un patrón
decusado. Estas observaciones indican que las mutaciones semidominantes de ICU4
dan lugar a un retraso en el cambio de la fase juvenil a la adulta. Cabe destacar en
este sentido que la mutación hst-1 también afecta al cambio de fase, aunque en este
caso produciendo un adelanto (Telfer y Poethig, 1998). El hecho de que los dos genes
participen en el mismo proceso regulador del cambio de fase viene sugerido por el
fenotipo de adelanto en el doble mutante, que indica que icu4-1 es epistático sobre
hst-1 para el cambio de fase.
El patrón vascular primario del tallo está estrechamente coordinado con el
patrón de filotaxia (Steeves y Sussex, 1989; Kang et al., 2003), lo que permite que los
Discusión 125
tejidos vasculares de las hojas y flores dispuestas con una filotaxia concreta alrededor
del tallo encuentren una rápida conexión con los haces vasculares que discurren por
éste. La filotaxia espiral de Arabidopsis se observa en que las posiciones de las hojas
y las flores van formando hélices a lo largo del tallo, con ángulos de divergencia o
separación entre órganos sucesivos próximos a 137,5° (Callos y Medford, 1994; Byrne
et al., 2003); y se representa por una fracción en la que, en el numerador, se indica el
número de vueltas necesario para pasar de una hoja o flor, con una posición
determinada en el tallo, hasta otra que esté directamente sobre la posición inicial, y en
el denominador viene expresado el número total de hojas o flores encontradas en los
giros anteriores alrededor del tallo. En Arabidopsis, la filotaxia viene definida por la
fracción 3/8 o 5/8, dependiendo de si el sentido en el que sigamos el giro es dextrorso
o hacia la izquierda, y se ajusta a la serie numérica propuesta por Fibonacci en el siglo
XIII (Callos y Medford, 1994; Byrne et al., 2003). Un dato a destacar es que el número
de hojas o flores que encontramos desde una posición inicial n en el tallo hasta una
localización inmediatamente por encima de ésta es 8 (posición n+8), que coincide con
el número de haces vasculares que encontramos habitualmente en las secciones de
los tallos de Arabidopsis. Es decir, el número de posiciones de inserción de órganos
alrededor de la circunferencia de un tallo es el mismo que el número de haces
vasculares.
La íntima conexión entre los dos procesos hace que sea habitual encontrar
mutantes que están afectados tanto en el patrón vascular como en la filotaxia, tal y
como ocurre en icu4-1 e icu4-2 y las plantas carentes de la función del gen
PENNYWISE (PNY), observándose asimismo un efecto sinérgico entre ambos tipos de
mutantes que demuestra la participación de los genes en los dos procesos, ya sea en
la misma vía o en vías paralelas. Un dato adicional a favor lo constituye el hecho de
que las plantas dobles homocigotas para mutaciones de pérdida de función en PNY y
su parálogo POUND-FOOLISH (PNF) presentan filotaxia decusada en todas las hojas
de la roseta basal y nunca florecen (Smith et al., 2004), un fenotipo que recuerda al de
los mutantes icu4-1 e icu4-2, aunque mucho más fuerte.
Una pregunta obvia a responder sería de qué manera se produce la
coordinación de ambos procesos. Inicialmente, se sugirió que los órganos situados en
el tallo con patrones filotácticos específicos sintetizarían auxina que, al ser exportada,
determinaría la formación de los haces vasculares en posiciones concretas (revisado
en Steeves y Sussex, 1989; revisado en Leyser y Day, 2003). No obstante, la
presencia de sistemas vasculares en los tallos carentes de órganos de las plantas con
un transporte polar de auxinas muy reducido, como son el mutante pin-1 o las plantas
tratadas con NPA, indica que la estructura organizada de los haces vasculares se
Discusión 126
produce con independencia de los órganos laterales (Mattson et al., 1999).
Alternativamente, también se ha propuesto que los haces vasculares del tallo podrían
ser los que guiaran el patrón filotáctico de las hojas y flores (revisado en Leyser y Day,
2003). Sin embargo, la hipótesis actual para explicar la filotaxia argumenta que se
debe a la inducción de órganos por la auxina transportada de forma polar a través de
la epidermis, y no a través de los haces vasculares, teniendo lugar la formación de los
órganos en las zonas periféricas del meristemo en las que se alcanza un máximo en la
concentración de auxina. La acumulación de auxina en la región que formará el órgano
da lugar a la eliminación de la fitohormona de las regiones circundantes, por lo que en
éstas no se producirá la organogénesis (Reinhardt et al., 2003). Por lo tanto, la
formación del patrón filotáctico tendría lugar independientemente del patrón de haces
vasculares en el tallo.
Un hecho importante que se desprende de lo comentado en el párrafo anterior
es que, de forma similar a lo que ocurre en el establecimiento del patrón vascular, la
auxina también tiene una función inductora en la iniciación de los órganos en el tallo y
participa en la regulación de la filotaxia (Reinhardt et al., 2000; 2003; Vernoux et al.,
2000). De hecho, la hipótesis comentada anteriormente para explicar cómo se genera
la filotaxia no es más que una ligera modificación del mecanismo de difusión-reacción,
también propuesto como explicación para la formación del patrón vascular, donde
habría un componente autocatalítico inductor representado por la auxina y su
transporte polar, así como un componente de inhibición lateral que, en este caso, sería
la eliminación de la auxina de los tejidos circundantes (Meinhardt, 1982; 1984;
Reinhardt et al., 2003). En cualquier caso, una hipótesis análoga a la utilizada para
explicar la formación del patrón vascular según el modelo de difusión-rección. Por
tanto, a pesar de que no haya señales instructivas del patrón de filotaxia al patrón
vascular o, viceversa, del segundo hacia el primero, la estrecha correlación entre
ambos patrones podría explicarse por la intervención de un mecanismo similar en los
dos procesos, que incluiría la función de genes que estarían participando tanto en la
formación del patrón de filotaxia como en el establecimiento de la posición de los
haces vasculares en la eustela. Es interesante considerar en este sentido que se ha
especulado que el gen PNY podría estar integrando las señales de hormonas como
las auxinas y las giberelinas para establecer el patrón correcto de órganos alrededor
del tallo (Smith y Hake, 2003).
VI.- Conclusiones
Conclusiones 128
VI.- Conclusiones
I.- icu4-1 e icu4-2 son dos alelos semidominantes de ganancia de función del gen
ATHB15/CNA/ICU4, que pertenece a la familia génica HD-ZIP III.
II.- Los alelos icu4-1 e icu4-2 son portadores de la misma mutación puntual, que es a
su vez idéntica a la de varios alelos semidominantes de otros miembros de la familia
HD-ZIP III. Esta mutación se sitúa en la diana del miRNA165/166. La alteración del
proceso de regulación post-transcripcional, debida al desapareamiento entre el miRNA
y el mRNA de ICU4 provocado por la mutación, nos proporciona una explicación
molecular para la ganancia de función de los dos alelos.
III.- Los alelos icu4-1 e icu4-2 causan transformaciones adaxiales en los órganos
laterales e interaccionan de forma sinérgica con otras mutaciones que también afectan
al establecimiento del eje adaxial-abaxial, como hst-1, crc-1 y fil-3.
IV.- El fenotipo producido por los alelos icu4-1 e icu4-2 es termosensible y muy
pleiotrópico, ya que afecta no sólo al establecimiento del eje adaxial-abaxial, sino
también al cambio de fase, a la filotaxia, al patrón radial de los tallos y a la
embriogénesis.
V.- Los alelos de pérdida de función del gen ICU4 no muestran fenotipo mutante, lo
que puede ser atribuible a la redundancia funcional existente entre los miembros de la
familia HD-ZIP III.
VI.- El gen ICU4 promueve el desarrollo de los tejidos vasculares en el tallo,
fundamentalmente a través de la estimulación de la proliferación de las células del
procámbium, y regula el número de haces vasculares en la eustela.
VII.- La localización precisa de los patrones de expresión de los genes HD-ZIP III,
debida a la actividad de sus promotores y a la regulación post-transcripcional mediada
por miRNA, confiere información posicional para la organización del patrón colateral en
los haces vasculares y el establecimiento del conjunto del patrón radial en los tallos.
Conclusiones 129
VIII.- Proponemos como hipótesis que los productos HD-ZIP III estarían formando un
prepatrón sobre el cual se canalizaría el flujo polar de auxina, de manera que la
formación de un haz vascular y la intensidad del flujo a través de él dependería de la
concentración de auxina, que estaría actuando como morfógeno, y de los productos
HD-ZIP III, que determinarían la respuesta final de las células.
IX.- Nuestros resultados apoyan que, en la formación de los haces vasculares del tallo,
además de la canalización del flujo de auxina, también hay un proceso de inhibición
lateral debido a una sustancia inhibidora aún por descubrir, tal y como propone la
hipótesis de la difusión-reacción.
X.- Hemos observado relaciones sinérgicas y antagónicas entre distintos alelos
mutantes de miembros de la familia HD-ZIP III, que proponemos pueda deberse a la
formación de homo y heterodímeros con diferentes capacidades funcionales.
XI.- La estrecha correlación entre el patrón vascular del tallo y la filotaxia puede
explicarse por la intervención de un mecanismo similar en el establecimiento de ambos
patrones. Esto hace que sea habitual encontrar genes afectados en los dos procesos,
tal y como ocurre en icu4-1 y en los mutantes de pérdida de función del gen PNY,
observándose asimismo un efecto sinérgico entre ambos tipos de alelos que
demuestra la participación de los genes en los dos procesos, ya sea en la misma vía o
en vías paralelas.
VII.- Bibliografía
Bibliografía 129
VII.- Bibliografía
Adams, M.D., Celniker, S.E., Holt, R.A., Evans, C.A., Gocayne, J.D., Amanatides, P.G.
et al. (2000). The genome sequence of Drosophila melanogaster. Science 287:
2185-2195.
Al-Hammadi, A.S., Sreelakshmi, Y., Negi, S., Siddiqi, I. y Sharma, R. (2003). The
polycotyledon mutant of tomato shows enhanced polar auxin transport. Plant
Physiol. 133, 113-125.
Al Shehbaz, I. A. (1984). The tribes of Cruciferae (Brassicaceae) in the south-eastern.
J. Arnold Arbor 65: 343-373.
Aloni, R. (1987). Differentiation of vascular tissues. Annu. Rev. Plant. Biol. 38, 179–
204.
Alonso, J.M., Stepanova, A.N., Leisse, T.J., Kim, C.J., Chen, H., Shinn, P., Stevenson,
D.K., Zimmerman, J., Barajas, P., Cheuk, R., Gadrinab, C., Heller, C., Jeske, A.,
Koesema, E., Meyers, C.C., Parker, H., Prednis, L., Ansari, Y., Choy, N., Deen, H.,
Geralt, M., Hazari, N., Hom, E., Karnes, M., Mulholland, C., Ndubaku, R., Schmidt,
I., Guzman, P., Aguilar-Henonin, L., Schmid, M., Weigel, D., Carter, D.E., Marchand,
T., Risseeuw, E., Brogden, D., Zeko, A., Crosby, W.L., Berry, C.C. y Ecker, J.R.
(2003). Genome-Wide Insertional Mutagenesis of Arabidopsis thaliana. Science
301, 653-657.
Altschul, S.F., Madden, T.L., Schaffer, A.A., Zhang, Z., Miller, W. y Lipman, D.J.
(1997). Gapped BLAST and PSI-BLAST: a new generation of proteins database
search programs. Nucleic Acids Res. 25, 3389-3402.
Alvarez, J. y Smyth, D.R. (1999). CRABS CLAW and SPATULA, two Arabidopsis
genes that control carpel development in parallel with AGAMOUS. Development
126, 2377-2386.
Aoyama, T., Dong, C.H., Wu, Y., Carabelli, M., Sessa, G., Ruberti, I., Morelli, G. y
Chua, N.H. (1995). Ectopic expression of the Arabidopsis transcriptional activator
Athb-1 alters leaf cell fate in tobacco. Plant Cell 7, 1773-1785.
Aukerman, M.J. y Sakai, H. (2003). Regulation of flowering time and floral organ
identity by a MicroRNA and its APETALA2-like target genes. Plant Cell 15, 27302741.
Baima, S., Nobili, F., Sessa, G., Lucchetti, S., Ruberti, I. y Morelli, G. (1995). The
expression of the Athb-8 homeobox gene is restricted to provascular cells in
Arabidopsis thaliana. Development 121, 4171-4182.
Baima, S., Possenti, M., Matteucci, A., Wisman, E., Altamura, M.M., Ruberti, I. y
Bibliografía 130
Morelli, G. (2001). The Arabidopsis ATHB-8 HD-zip protein acts as a differentiationpromoting transcription factor of the vascular meristems. Plant Physiol. 126, 643655.
Bancroft, I., Bhatt, A.M., Sjodin, C., Scofield, S., Jones, J.D. y Dean, C. (1992).
Development of an efficient two-element transposon tagging system in Arabidopsis
thaliana. Mol. Gen. Genet. 233, 449-461.
Bao, N., Lye, K.W. y Barton, M.K. (2004). MicroRNA binding sites in Arabidopsis class
III HD-ZIP mRNAs are required for methylation of the template chromosome. Dev
Cell 7, 653-662.
Bartel, B. y Bartel, D.P. (2003). miRNAs: at the root of plant development?. Plant
Physiol. 132, 709-717.
Barton, M.K. y Poethig, R.S. (1993). Formation of the shoot apical meristem in
Arabidopsis: an analysis of development in the wild type and in the shoot
meristemless mutant. Development 119, 823-831.
Bateman, A., Coin, L., Durbin, R., Finn, R.D., Hollich, V., Griffiths-Jones, S., Khanna,
A., Marshall, M., Moxon, S., Sonnhamme,r E.L., Studholme, D.J., Yeats, C. y Eddy,
S.R. (2004). The Pfam protein families database. Nucleic Acids Res. 32 (Database
issue), D138-141.
Baulcombe, D.C., Saunders, G.R., Bevan, M.W., Mayo, M.A. y Harrison, B.D. (1986).
Expression of biologically-active viral satellite RNA from the nuclear genome of
transformed plants. Nature 321, 446-449.
Bäurle, I. y Laux, T. (2003). Apical meristems: the plant’s fountain of youth. Bioessays
25: 961-970.
Bechtold, N., Ellis, J. y Pelletier, G. (1993). In planta Agrobacterium mediated gene
transfer by infiltration of adult Arabidopsis thaliana plants. C. R. Acad. Sci. 316,
1194-1199.
Bechtold, N. y Pelletier, G. (1998) In planta Agrobacterium-mediated transformation of
adult Arabidopsis thaliana plants by vacuum infiltration. Methods Mol. Biol. 82, 250266.
Benjamins, R., Quint, A., Weijers, D., Hooykaas, P. y Offringa ,R. (2001). The PINOID
protein kinase regulates organ development in Arabidopsis by enhancing polar
auxin transport. Development 128, 4057-4067.
Bennett, M., Kieber, J., Giraudat, J. y Morris, P. (1998). Hormone regulated
development. En Arabidopsis, Annual Plant Reviews. Vol. 1. M. Anderson y J. A.
Roberts (eds.), pp. 107-150. Sheffield: Sheffield Academic Press.
Benson, D.A., Karsch-Mizrachi, I., Lipman, D.J., Ostell, J., Rapp, B.A. y Wheeler, D.L.
(2002). GenBank. Nucleic Acid Res. 30, 17-20.
Bibliografía 131
Berleth, T. y Mattsson, J. (2000). Vascular development: tracing signals along veins.
Curr. Opin. Plant Biol. 3, 406-411.
Berná, G., Robles, P. y Micol, J.L. (1999). A mutational analysis of leaf morphogenesis
in Arabidopsis thaliana. Genetics 152, 729-742.
Bernstein, E. y Caudy, A.A., Hammond, S.M. y Hannon, G.J. (2001). Role for a
bidentate ribonuclease in the initiation step of RNA interference. Nature 409, 363366.
Blázquez, M.A. y Weigel, D. (2000). Integration of floral inductive signals in
Arabidopsis. Nature. 404, 889-892.
Blázquez, M.A., Koornneef, M. y Putterill, J. (2001). Flowering on time: Genes that
regulate the floral transition. EMBO Rep. 2: 1078-1082.
Bleecker, A.B., Estelle, M.A., Somerville, C. y Kende, H. (1988). Insensitivity to
ethylene conferred by a dominant mutation in Arabidopsis thaliana. Science 241,
1086-1089.
Bohmert, K., Camus, I., Bellini, C., Bouchez, D., Caboche, M. y Benning, C. (1998).
AGO1 defines a novel locus of Arabidopsis controlling leaf development. EMBO J.
17, 170-180.
Bohnsack, M.T., Czaplinski, K. y Gorlich, D. (2004). Exportin 5 is a RanGTP-dependent
dsRNA-binding protein that mediates nuclear export of pre-miRNAs. RNA 10, 185191.
Bollman, K.M., Aukerman, M.J., Park, M.Y., Hunter, C., Berardini, T.Z. y Poethig, R.S.
(2003). HASTY, the Arabidopsis ortholog of exportin 5/MSN5, regulates phase
change and morphogenesis. Development 130, 1493-1504.
Bolker, J. A. (1995). Model systems in developmental biology. Bioessays 17, 451-455.
Bowman, J.L., Smyth, D.R. y Meyerowitz, E.M. (1989). Genes directing flower
development in Arabidopsis. Plant Cell 1, 37-52.
Bowman, J.L., Smyth, D.R. y Meyerowitz, E.M. (1991). Genetic interactions among
floral homeotic genes of Arabidopsis. Development 112, 1-20.
Bowman, J.L., Álvarez, J., Weigel, D., Meyerowitz, E. M. y Smyth, D. R. (1993). Control
of flower development in Arabidopsis thaliana by APETALA1 and interacting genes.
Development 119, 721-743.
Bowman, J. L. (1994). Arabidopsis. An atlas of morphology and development. Springer
Verlag. Singapur.
Bowman J.L., Baum, S.F., Eshed, Y., Putterill, J. y Álvarez, J. (1999). Molecular
genetics of gynoecium development in Arabidopsis. Curr. Top. Dev. Biol. 45, 155205.
Bowman, J.L. y Smyth, D.R. (1999). CRABS CLAW, a gene that regulates carpel and
Bibliografía 132
nectary development in Arabidopsis, encodes a novel protein with zinc finger and
helix-loop-helix domains. Development 126, 2387-2396.
Bowman, J.L., Eshed, Y. y Baum, S.F. (2002). Establishment of polarity in angiosperm
lateral organs. Trends Genet. 18, 134-141.
Brand, U., Fletcher, J.C., Hobe, M., Meyerowitz, E.M. y Simon, R. (2000). Dependence
of stem cell fate in Arabidopsis on a feedback loop regulated by CLV3 activity.
Science 289, 617-619.
Bürger, D. (1971). Die morphologischen mutanten des Göttinger Arabidopsissortiments, einschlieslich der mutanten mit abweichender samenfarbe. Arabid. Inf.
Serv. 8, 36-42.
Byrne, M.E., Barley, R., Curtis, M., Arroyo, J.M., Dunham, M., Hudson, A.,
Martienssen, R.A. (2000). Asymmetric leaves1 mediates leaf patterning and stem
cell function in Arabidopsis. Nature 408, 967-71.
Byrne, M.E., Simorowski, J. y Martienssen, R.A. (2002). ASYMMETRIC LEAVES1
reveals knox gene redundancy in Arabidopsis. Development 129, 1957-1965.
Byrne, M.E., Groover, A.T., Fontana, J.R. y Martienssen, R.A. (2003). Phyllotactic
pattern and stem cell fate are determined by the Arabidopsis homeobox gene
BELLRINGER. Development 130, 3941-3950.
Calado, A., Treichel, N., Muller, E.C., Otto, A. y Kutay, U. (2002). Exportin-5-mediated
nuclear export of eukaryotic elongation factor 1A and tRNA. EMBO J. 21, 62166224.
Callos, J.D. y Medford, J.I. (1994). Organ positions and pattern formation in the shoot
apex. Plant Journal 6, 1-7.
Campos-Ortega, J.A. (1994). Evolución histórica de la Biología del desarrollo. En
Descifrar la vida, pp. 221-241. Casadesús, J. y Ruiz Barraquero, F. (eds.).
Universidad de Sevilla.
Candela, H., Martínez-Laborda, A. y Micol, J.L. (1999). Venation pattern formation in
Arabidopsis thaliana vegetative leaves. Dev. Biol. 205, 205-216.
Candela Antón, H. (2001). Análisis genético de la formación del patrón de venación en
la hoja de Arabidopsis thaliana. Tesis Doctotal. Universidad Miguel Hernández.
Carabelli, M., Sessa, G., Baima, S., Morelli, G. y Ruberti, I. (1993). The Arabidopsis
Athb-2 and -4 genes are strongly induced by far-red-rich light. Plant J. 4, 469-479.
Carabelli, M., Morelli, G., Whitelam, G. y Ruberti, I. (1996) Twilight-zone and canopy
shade induction of the Athb-2 homeobox gene in green plants. Proc Natl Acad Sci U
S A 93, 3530-5.
Carland, F. M., Berg, B. L., FitzGerald, J. N., Jinamornphongs, S., Nelson, T. y Keith,
B. (1999). Genetic regulation of vascular tissue patterning in Arabidopsis. Plant Cell
Bibliografía 133
11, 2123-2137.
Chan, R.L. y Gonzalez, D.H. (1994). A cDNA encoding an HD-zip protein from
sunflower. Plant Physiol. 106, 1687-1688.
Chen, Q., Atkinson, A., Otsuga, D., Christensen, T., Reynolds, L. y Drews, G.N. (1999).
The Arabidopsis FILAMENTOUS FLOWER gene is required for flower formation.
Development 126, 2715-2726.
Chen, X. y Meyerowitz, E.M. (1999). HUA1 and HUA2 are two members of the floral
homeotic AGAMOUS pathway. Mol Cell 3, 349-360.
Chen, X., Liu, J., Cheng, Y. y Jia, D. (2002). HEN1 functions pleiotropically in
Arabidopsis development and acts in C function in the flower. Development 129,
1085-1094.
Chen, X. (2004). A microRNA as a translational repressor of APETALA2 in Arabidopsis
flower development. Science 303, 2022-2025.
Choi, S., Creelman, R.A. Mullet, J. y Wing, R.A. (1995). Construction and
characterization of bacterial artificial chromosome library of Arabidopsis thaliana.
Weeds World 2, 17-20.
Christensen, S.K., Dagenais, N., Chory, J. y Weigel, D. (2000). Regulation of auxin
response by the protein kinase PINOID. Cell 100, 469-478.
Cilia M.L. y Jakson D. (2004). Plasmodesmata form and function. Curr. Opin. Cell Biol.
16, 500-506.
Clark, S.E., Running, M.P. y Meyerowitz, E.M. (1993). CLAVATA1, a regulator of
meristem and flower development in Arabidopsis. Development 119, 397-418.
Clark, S.E.; Williams, R.W. y Meyerowitz E.M. (1997). The CLAVATA1 gene encodes a
putative receptor kinase that controls shoot and floral meristem size in Arabidopsis.
Cell 89, 575-585.
Clough, S.J. y Bent, A.F. (1998). Floral dip: a simplified method for Agrobacteriummediated transformation of Arabidopsis thaliana. Plant J. 16, 735-743.
Coen, E.S. y Meyerowitz, E.M. (1991). The war of the whorls: genetic interactions
controlling flower development. Nature 353, 31-37.
Coen, E.S. (1992). Flower development. Curr. Opin. Cell Biol. 6, 929-933.
Deyholos, M.K., Cordner, G., Beebe, D. y Sieburth, L.E. (2000). The SCAREFACE
gene is required for cotyledon and leaf vein patterning. Development 127, 32053213.
Di Cristina, M., Sessa, G., Dolan, L., Linstead, P., Baima, S., Ruberti, I. y Morelli, G.
(1996). The Arabidopsis Athb-10 (GLABRA2) is an HD-Zip protein required for
regulation of root hair development. Plant J. 10, 393-402.
Di Laurenzio, L., Wysocka-Diller, J., Malamy, J.E., Pysh, L., Helariutta, Y., Freshour,
Bibliografía 134
G., Hahn, M.G., Feldmann, K.A. y Benfey, P.N. (1996). The SCARECROW gene
regulates an asymmetric cell division that is essential for generating the radial
organization of the Arabidopsis root. Cell 86, 423-433.
Dievart, A., Dalal, M., Tax, F.E., Lacey, A.D., Huttly, A., Li, J. y Clark, S.E. (2003).
CLAVATA1 dominant-negative alleles reveal functional overlap between multiple
receptor kinases that regulate meristem and organ development. Plant Cell 15,
1198–1211.
Dinneny, J.R. y Yanofsky, M.F. (2004). Vascular patterning: xylem or phloem?. Curr
Biol. 14, R112-114.
Ditta, G., Pinyopich, A., Robles, P., Pelaz, S. y Yanofsky, M.F. (2004). The SEP4 gene
of Arabidopsis thaliana functions in floral organ and meristem identity. Curr Biol. 14,
1935-1940.
Dolan, L., Janmaat, K., Willemsen, V., Linstead, P., Poethig, S., Roberts, K. y Scheres,
B. (1993). Cellular organisation of the Arabidopsis thaliana root. Development 119,
71-84.
Douglas, S.J., Chuck, G., Dengler, R.E., Pelecanda, L. y Riggs, C.D. (2002). KNAT1
and ERECTA regulate inflorescence architecture in Arabidopsis. Plant Cell 14, 54758.
Dugas, D.V. y Bartel, B. (2004). MicroRNA regulation of gene expression in plants.
Curr. Opin. Plant Biol. 7, 512-520.
Eckardt,
N.A.
(2005).
MicroRNAs
Regulate
Auxin
Homeostasis
and
Plant
Development. The Plant Cell 17,1335-1338.
Emery, J.F., Floyd, S.K., Alvarez, J., Eshed, Y., Hawker, N.P., Izhaki, A., Baum, S.F. y
Bowman, J.L. (2003). Radial patterning of Arabidopsis shoots by class III HD-ZIP
and KANADI genes. Curr. Biol. 13, 1768-1774.
Engstrom, E.M., Izhaki, A. y Bowman, J.L. (2004). Promoter Bashing, microRNAs, and
Knox Genes. New Insights, Regulators, and Targets-of-Regulation in the
Establishment of Lateral Organ Polarity in Arabidopsis. Plant Physiol. 135, 685-694.
Esau K. (1965). Vascular differentiation in plants. New York, USA: Holt Rinehart and
Winston.
Eshed, Y., Baum, S.F. y Bowman, J.L. (1999). Distinct mechanisms promote polarity
establishment in carpels of Arabidopsis. Cell 99, 199-209.
Eshed, Y., Baum, S.F., Perea, J.V. y Bowman, J.L. (2001). Establishment of polarity in
lateral organs of plants. Curr. Biol. 11, 1251-1260.
Estelle, M.A. y Somerville, C.R. (1986). The mutants of Arabidopsis. Trends Genet. 2:
89-193.
Ferrándiz, C., Pelaz, S. y Yanofsky, M.F. (1999). Control of carpel and fruit
Bibliografía 135
development in Arabidopsis. Annu. Rev. Biochem. 68, 321-354.
Ferrándiz, C., Liljegren, S.J. y Yanofsky, M.F. (2000). Negative regulation of the
SHATTERPROOF genes by FRUITFULL during Arabidopsis fruit development.
Science 289, 436-438.
Fletcher, J.C., Brand, U., Running, M.P., Simon, R. y Meyerowitz, E.M. (1999)
Signaling of cell fate decisions by CLAVATA3 in Arabidopsis shoot meristems.
Science 283, 1911-1914.
Floyd, S.K. y Bowman, J.L. (2004). Gene regulation: ancient miRNA target sequences
in plants. Nature 428, 485-486.
Fosket, D. E. (1994). Plant Growth and Development. A Molecular Approach.
Academic Press, Inc.
Franklin, K.A., Davis, S.J., Stoddart, W.M., Vierstra, R.D. y Whitelam, G.C. (2003).
Mutant analyses define multiple roles for phytochrome C in Arabidopsis
photomorphogenesis. Plant Cell 15, 1981–1989.
Friml, J., Vieten, A., Sauer, M., Weijers, D., Schwarz, H., Hamann, T., Offringa, R. y
Jürgens, G. (2003). Efflux-dependent auxin gradients establish the apical-basal axis
of Arabidopsis. Nature 426, 147–153.
Fukuda, H. (2004). Signals that control plant vascular cell differentiation. Nat. Rev. Mol.
Cell. Biol. 5, 379-91.
Furutani, M., Vernoux, T., Traas, J., Kato, T., Tasaka, M. y Aida, M. (2004). PINFORMED1 and PINOID regulate boundary formation and cotyledon development in
Arabidopsis embryogenesis. Development 131, 5021-5030.
Galinat, W.C. (1959). The phytomer in relation to the floral homologies in the American
Maydea. Bot. Mus. Leafl., Harv. Univ. 19, 1-32.
Gälweiler, L., Guan, C. H., Muller, A., Wisman, E., Mendgen, K., Yephremov, A. y
Palme, K. (1998). Regulation of polar auxin transport by AtPIN1 in Arabidopsis
vascular tissue. Science 282, 2226-2230.
García-Bellido, A. (1986). Genetic analysis of morphogenesis. En Genetics,
development and evolution. Gustafson, J.P., Stebbins, G.L. y Ayala, F.J. (eds.).
Plenum Publishing Corporation.
García-Hernández M., Berardini T.Z., Chen G., Crist D., Doyle A., Huala E., Knee E.,
Lambrecht M., Miller N., Mueller L.A., Mundodi S., Reiser L., Rhee S.Y., Scholl R.,
Tacklind J., Weems D.C., Wu Y., Xu I., Yoo D., Yoon J. y Zhang P. TAIR: a
resource for integrated Arabidopsis data. Funct. Integr. Genomics 2, 239-53.
Gehring, W.J. (1992). The homeobox in perspective. Trends Biochem Sci. 17, 277-280.
Gilbert, S.F. (2003). Developmental Biology. 7ª Edición. Sinauer Associates,
Sunderland, MA.
Bibliografía 136
Goethe, J.W. von (1790). Versuch die Metamorphose der Pflanzen zu Erklären. Gotha:
C.W. Ettinger.
Golden, T.A., Schauer, S.E., Lang, J.D., Pien, S., Mushegian, A.R., Grossniklaus, U.,
Meinke, D.W. y Ray, A. (2002). SHORT INTEGUMENTS1/SUSPENSOR1/CARPEL
FACTORY, a Dicer homolog, is a maternal effect gene required for embryo
development in Arabidopsis. Plant Physiol. 130, 808-822.
Golz, J.F. y Hudson, A. (2002). Signalling in plant lateral organ development. Plant
Cell.14 Suppl, S277-288.
Goodrich, J., Puangsomlee, P., Martin, M., Long, D., Meyerowitz, E.M. y Coupland, G.
(1997). A Polycomb-group gene regulates homeotic gene expression in Arabidopsis.
Nature 386, 44-51.
Green, K.A., Prigge, M.J., Katzman, R.B. y Clark, S.E. (2005). CORONA, a Member of
the Class III Homeodomain Leucine Zipper Gene Family in Arabidopsis, Regulates
Stem Cell Specification and Organogenesis. Plant Cell 17, 691-704
Gu, Q., Ferrándiz, C., Yanofsky, M.F. y Martienssen, R. (1998). The FRUITFULL
MADS-box gene mediates cell differentiation during Arabidopsis fruit development.
Development 125, 1509-1517.
Gwizdek, C., Ossareh-Nazari, B., Brownawell, A.M., Doglio, A., Bertrand, E., Macara,
I.G. y Dargemont, C. (2003). Exportin-5 mediates nuclear export of minihelixcontaining RNAs. J. Biol. Chem. 278, 5505-5508.
Hanahan, D. (1983). Studies on transformation of Escherichia coli with plasmids. J.
Mol. Biol. 166, 557-580.
Hanzawa, Y., Takahashi, T. y Komeda, Y. (1997). ACL5: an Arabidopsis gene required
for internodal elongation after flowering. Plant J. 12, 863-874.
Haughn, G.W., Schultz, E.A. y Martínez-Zapater, J.M. (1995). The regulation of
flowering in Arabidopsis thaliana: meristems, morphogenesis, and mutants. Can. J.
Bot. 73, 959-981.
Hawker, N.P. y Bowman, J.L. (2004). Roles for Class III HD-Zip and KANADI Genes in
Arabidopsis Root Development. Plant Physiol. 135, 2261-2270.
Heisler, M.G., Atkinson, A., Bylstra, Y.H., Walsh, R. y Smyth, D.R. (2001). SPATULA, a
gene that controls development of carpel margin tissues in Arabidopsis, encodes a
bHLH protein. Development 128, 1089-1098.
Higgins, D.G., Thompson, J.D. y Gibson, T.J. (1996). Using CLUSTAL for multiple
sequence alignments. Methods Enzymol. 266, 383-402.
Hoekema, A., Hirch, P.R., Hooykaas, P.J. y Schilperoot, R.A. (1983). A binary plant
vector based on separation of vir and T-region of the A. tumefaciens Ti plasmid.
Nature 303, 178-180.
Bibliografía 137
Howell, S.H. (1998). Molecular Genetics of Plant Development. Cambrige University
Press.
Hua, J. y Meyerowitz, E.M. (1998). Ethylene responses are negatively regulated by a
receptor gene family in Arabidopsis thaliana. Cell 94, 261–271.
Huala, E. y Sussex, I.M. (1992). LEAFY Interacts with Floral Homeotic Genes to
Regulate Arabidopsis Floral Development. Plant Cell 4, 901-913.
Ingram, G.C., Goodrich, J., Wilkinson, M.D., Simon, R., Haughn, G.W. y Coen, E.S.
(1995). Parallels between UNUSUAL FLORAL ORGANS and FIMBRIATA, genes
controlling flower development in Arabidopsis and Antirrhinum. Plant Cell. 7, 15011510.
Innan, H., Terauchi, R. y Miyashita, N.T. (1997). Microsatellite polymorphism in natural
populations of the wild plant Arabidopsis thaliana. Genetics 146: 1441-1452.
International Human Genome Mapping Consortium. (2001). A physical map of the
human genome. Nature 409, 934-941.
Irish, V.F. y Sussex, I.M. (1990). Function of the apetala-1 gene during Arabidopsis
floral development. Plant Cell 2,741-53.
Iwakawa, H., Ueno, Y., Semiarti, E., Onouchi, H., Kojima, S., Tsukaya, H., Hasebe, M.,
Soma, T., Ikezaki, M., Machida, C. y Machida, Y. (2002). The ASYMMETRIC
LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat
leaf lamina, encodes a member of a novel family of proteins characterized by
cysteine repeats and a leucine zipper. Plant Cell Physiol. 43, 467-78.
Jacobs, W. P. (1952). The role of auxin in differentiation of xylem around a wound. Am.
J. Bot. 39, 327-337.
Jacobsen, S.E., Running, M.P. y Meyerowitz, E.M. (1999). Disruption of an RNA
helicase/RNAse III gene in Arabidopsis causes unregulated cell division in floral
meristems. Development 126, 5231-5243.
Jofuku, K.D., den Boer, B.G., Van Montagu, M. y Okamuro, J.K. (1994). Control of
Arabidopsis flower and seed development by the homeotic gene APETALA2. Plant
Cell 6, 1211-1225.
Jones-Rhoades, M.W. y Bartel, D.P. (2004). Computational Identification of Plant
MicroRNAs and Their Targets, Including a Stress-Induced miRNA. Mol. Cell 14,
787-799.
Juarez, M.T., Kui, J.S., Thomas, J., Heller, B.A. y Timmermans, M.C. (2004a). miRNAmediated repression of rolled leaf1 specifies maize leaf polarity. Nature 428, 84-88.
Juarez, M.T., Twigg, R.W. y Timmermans, M.C. (2004b). Specification of adaxial cell
fate during maize leaf development. Development 131, 4533-4544.
Jun, J.H., Ha, C.M. y Nam, H.G. (2002). Involvement of the VEP1 gene in vascular
Bibliografía 138
strand development in Arabidopsis thaliana. Plant Cell Physiol. 43, 323-330.
Jürgens, G., Mayer, U., Torres-Ruiz, R.A., Berleth, T. y Miséra, S. (1991). Genetic
analysis of pattern formation in the Arabidopsis embryo. Dev. Suppl. 1: 27-38.
Kang, J., Tang, J., Donnelly, P. y Dengler, N. (2003). Primary vascular pattern and
expression of ATHB-8 in shoots of Arabidopsis. New Phytologist 158, 443-454.
Kayes, J.M. y Clark, S.E. (1998). CLAVATA2, a regulator of meristem and organ
development in Arabidopsis. Development 125, 3843-3851.
Kerstetter, R.A. y Hake, S. (1997). Shoot Meristem Formation in Vegetative
Development. Plant Cell 9,1001-1010.
Kerstetter, R.A., Bollman, K., Taylor, R.A., Bomblies, K. y Poethig, R.S. (2001).
KANADI regulates organ polarity in Arabidopsis. Nature 411, 706-709.
Kidner, C.A. y Martienssen, R.A. (2004). Spatially restricted microRNA directs leaf
polarity through ARGONAUTE1. Nature 428, 81-84.
Kim, J., Jung, J.H., Reyes, J.L., Kim, Y.S., Kim, S.Y., Chung, K.S., Kim, J.A., Lee, M.,
Lee, Y., Kim, V.N., Chua, N.H. y Park, C.M. (2005). microRNA-directed cleavage of
ATHB15 mRNA regulates vascular development in Arabidopsis inflorescence stems.
Plant J. 42, 84-94.
Koch, A.J. y Meinhardt, H. (1994). Biological pattern formation: from basic mechanisms
to complex structures. Rev. Mod. Phys. 66, 1481-1507.
Koizumi, K., Sugiyama, M. y Fukuda, H. (2000). A series of novel mutants of
Arabidopsis thaliana that are defective in the formation of continuous vascular
network: calling the auxin signal flow canalization hypothesis into question.
Development 127, 3197-3204.
Koncz, C., Nemeth, K., Redei, G.P. y Schell J. (1992). T-DNA insertional mutagenesis
in Arabidopsis. Plant Mol. Biol. 5, 963-976.
Koornneef, M., van Eden, J., Hanhart, C.J., Stem, P., Braaksma, F.J. y Feenstra, W.J.
(1983). Linkage map of Arabidopsis thaliana. J. Hered. 74, 265–272.
Koornneef, M., Hanhart, C.J. y van der Veen, J.H. (1991). A genetic and physiological
analysis of late flowering mutants in Arabidopsis thaliana. Mol. Gen. Genet. 229, 5766.
Koornneef, M. (1997). Plant development: timing when to flower. Curr Biol. 7,651-652.
Kranz, A.R. (1978). Demostration of new and additional population samples and
mutant lines of the AIS-seed bank. Arabid. Inf. Serv. 15, 118-139.
Kubo, H., Peeters, A.J., Aarts, M.G., Pereira, A. y Koornneef, M. (1999).
ANTHOCYANINLESS2, a homeobox gene affecting anthocyanin distribution and
root development in Arabidopsis. Plant Cell 11, 1217-1226.
Kumaran, M.K., Bowman, J.L. y Sundaresan, V. (2002). YABBY polarity genes mediate
Bibliografía 139
the repression of KNOX homeobox genes in Arabidopsis. Plant Cell 14, 2761-2770.
Kunst, L., Klenz, J.E., Martinez-Zapater, J. y Haughn, G.W. (1989). AP2 Gene
Determines the Identity of Perianth Organs in Flowers of Arabidopsis thaliana. Plant
Cell. 1, 1195-1208.
Kuusk, S., Sohlberg, J.J., Long, J.A., Fridborg, I. y Sundberg, E. (2002). STY1 and
STY2 promote the formation of apical tissues during Arabidopsis gynoecium
development. Development 129, 4707-4717.
Laibach, F. (1907). Zur Frage nach der Individualitat der Chromosomen im
Pflanzenreich. Beith. Bot. Cbl. 11, 191-210.
Laibach, F. (1943). Arabidopsis thaliana (L.) Heynh. als object für genestiche und
entwicklungsphysiologische untersuchungen. Bot. Arch. 44, 439-455.
Laufs, P., Peaucelle, A., Morin, H. y Traas, J. (2004). MicroRNA regulation of the CUC
genes is required for boundary size control in Arabidopsis meristems. Development
131, 4311-4322.
Laux, T., Mayer, K.F., Berger, J. y Jürgens, G. (1996). The WUSCHEL gene is required
for shoot and floral meristem integrity in Arabidopsis. Development 122, 87-96.
Laux T. y Jurgens G. (1997). Embryogenesis: A New Start in Life. Plant Cell 9, 9891000.
Laux, T. (2003). The stem cell concept in plants: a matter of debate. Cell 113, 281-283.
Lawrence, P.A. y Morata, G. (1994). Homeobox genes: their function in Drosophila
segmentation and pattern formation. Cell 78, 181-189.
Lee, Y.H. y Chun, J.Y. (1998). A new homeodomain-leucine zipper gene from
Arabidopsis thaliana induced by water stress and abscisic acid treatment. Plant Mol.
Biol. 37, 377-384.
Lee, Y.H., Oh, H.S., Cheon, C.I., Hwang, I.T., Kim, Y.J. y Chun, J.Y. (2001). Structure
and expression of the Arabidopsis thaliana homeobox gene Athb-12. Biochem.
Biophys. Res. Commun. 284, 133-141.
Lenhard, M. y Laux, T. (2003). Stem cell homeostasis in the Arabidopsis shoot
meristem is regulated by intercellular movement of CLAVATA3 and its sequestration
by CLAVATA1. Development 130, 3163-3173.
Leutwiler, L.S., Hough-Evans, B.R. y Meyerowitz, E.M. (1984). The DNA of Arabidopsis
thaliana. Mol. Gen. Genet. 194: 15-23.
Levin, J.Z. y Meyerowitz, E.M. (1995). UFO: an Arabidopsis gene involved in both floral
meristem and floral organ development. Plant Cell 7, 529-48.
Leyser, O. y Day, S. (2003) Mechanisms in Plant Development. Blackwell Science,
Oxford, UK.
Lewis, B.P., Shih, I.H., Jones-Rhoades, M.W., Bartel, D.P. y Burge, C.B. (2003).
Bibliografía 140
Prediction of mammalian microRNA targets. Cell 115, 787-798.
Li, Y., Rosso, M.G., Strizhov, N., Viehoever, P. y Weisshaa,r B. (2003). GABI-Kat
SimpleSearch: a flanking sequence tag (FST) database for the identification of TDNA insertion mutants in Arabidopsis thaliana. Bioinformatics 19, 1441-1442.
Liljegren, S.J., Roeder, A.H., Kempin, S.A., Gremski, K., Ostergaard, L., Guimil, S.,
Reyes, D.K. y Yanofsky, M.F. (2004). Control of fruit patterning in Arabidopsis by
INDEHISCENT. Cell 116, 843-853.
Lin, W.C., Shuai, B. y Springer, P.S. (2003). The Arabidopsis LATERAL ORGAN
BOUNDARIES-domain gene ASYMMETRIC LEAVES2 functions in the repression
of KNOX gene expression and in adaxial-abaxial patterning. Plant Cell 15, 22412252.
Lincoln, C., Britton, J.H. y Estelle, M. (1990). Growth and development of the axr1
mutants of Arabidopsis. Plant Cell Nov 2, 1071-1080.
Lincoln, C., Long, J., Yamaguchi, J., Serikawa, K. y Hake, S. (1994). A knotted1-like
homeobox gene in Arabidopsis is expressed in the vegetative meristem and
dramatically alters leaf morphology when overexpressed in transgenic plants. Plant
Cell 6, 1859-1876.
Lohmann, J.U., Hong, R.L., Hobe, M., Busch, M.A., Parcy, F., Simon, R. y Weigel, D.
(2001). A molecular link between stem cell regulation and floral patterning in
Arabidopsis. Cell 105, 793-803.
Lohmann, J.U. y Weigel, D. (2002). Building beauty: the genetic control of floral
patterning. Dev. Cell 2, 135-142.
Long, J.A., Moan, E.I., Medford, J.I. y Barton, M.K. (1996). A member of the KNOTTED
class of homeodomain proteins encoded by the STM gene of Arabidopsis. Nature
379, 66-69.
Lyndon, R. F. (1990). Plant Development. Unwin Hyman.
Lynn, K., Fernandez, A., Aida, M., Sedbrook, J., Tasaka, M., Masson, P. y Barton, M.K.
(1999). The PINHEAD/ZWILLE gene acts pleiotropically in Arabidopsis development
and has overlapping functions with the ARGONAUTE1 gene. Development 126,
469-481.
Lu, C. y Fedoroff, N. (2000). A mutation in the Arabidopsis HYL1 gene encoding a
dsRNA binding protein affects responses to abscisic acid, auxin, and cytokinin. Plant
Cell 12, 2351-2366.
Mallory, A.C., Reinhart, B.J., Jones-Rhoades, M.W., Tang, G., Zamore, P.D., Barton,
M.K. y Bartel, D.P. (2004a). MicroRNA control of PHABULOSA in leaf development:
importance of pairing to the microRNA 5' region. EMBO J. 23, 3356-3364.
Mallory, A.C., Dugas, D.V., Bartel, D.P. y Bartel, B. (2004b). MicroRNA regulation of
Bibliografía 141
NAC-domain targets is required for proper formation and separation of adjacent
embryonic, vegetative, and floral organs. Curr. Biol.14, 1035-1046.
Mandel, M.A., Gustafson-Brown, C., Savidge, B. y Yanofsky, M.F. (1992). Molecular
characterization of the Arabidopsis floral homeotic gene APETALA1. Nature 360,
273-277.
Martínez, M.C., Jørgenson, J.E., Lawton, M., Lamb, C.J. y Doerner, P.W. (1992).
Spatial pattern of cdc2 expression in relation to meristem activity and cell
proliferation during plant development. Proc. Natl. Acad. Sci. USA 89, 7360-7364.
Martínez-Zapater, J.M., y Somerville, C.R. (1990). Effect of light quality and
vernalization on late-flowering mutants of Arabidopsis thaliana. Plant Physiol. 92:
770-776.
Martínez-Zapater, J.M., Coupland, G., Dean, C. y Koorneef, M. (1994). The transition
to flowering in Arabidopsis . En Arabidopsis, pp. 403-433. Meyerowitz, E.M. y
Somerville, C.R. (eds.). Cold Spring Harbor Laboratory Press. Nueva York.
Masucci, J.D., Rerie, W.G., Foreman, D.R., Zhang, M., Galway, M.E., Marks, M.D. y
Schiefelbein, J.W. (1996). The homeobox gene GLABRA2 is required for positiondependent cell differentiation in the root epidermis of Arabidopsis thaliana.
Development 122, 1253-1260.
Matsumoto, N. y Okada, K. (2001). A homeobox gene, PRESSED FLOWER, regulates
lateral axis-dependent development of Arabidopsis flowers. Genes Dev. 15, 33553364.
Mattson, J., Söderman, E., Svensonn, M., Borkird, C., y Engström, P. (1992). A new
homeobox-leucine zipper gene from Arabidopsis thaliana. Plant Mol. Biol. 18, 10191022.
Mattsson, J., Sung, Z.R. y Berleth, T. (1999). Responses of plant vascular systems to
auxin transport inhibition. Development 126, 2979-2991.
Mattsson, J., Ckurshumova, W. y Berleth, T. (2003) Auxin Signalling in Arabidopsis leaf
vascular development. Plant Physiol. 131, 1327–1339.
Mauseth, J.D. (1988). Plant Anatomy. Menlo Park, CA. Benjamin/Cummings.
Mayer K.F., Schoof, H., Haecker, A., Lenhard, M., Jürgens, G. y Laux, T. (1998). Role
of WUSCHEL in regulating stem cell fate in the Arabidopsis shoot meristem. Cell 95,
805-815.
Mayer, U., Torres-Ruiz, R.A., Berleth, T., Miséra, S. y Jürgens, G. (1991). Mutations
affecting body organization in the Arabidopsis embryo. Nature 353, 402-407.
Mayer, U., Büttner, G. y Jürgens, G. (1993) Apical-basal pattern formation in
Arabidopsis embryo: studies on the role of the GNOM gene. Development 117, 149162.
Bibliografía 142
McConnell, J.R. y Barton, M.K. (1995). Effect of mutations in the PINHEAD gene of
Arabidopsis on the formation of shoot apical meristems. Dev. Genet. 16, 358-366.
McConnell, J.R. y Barton, M.K. (1998). Leaf polarity and meristem formation in
Arabidopsis. Development 125, 2935-2942.
McConnell, J.R., Emery, J., Eshed, Y., Bao, N., Bowman, J. y Barton, M.K. (2001).
Role of PHABULOSA and PHAVOLUTA in determining radial patterning in shoots.
Nature 411, 709-713.
McElver, J., Tzafrir, I., Aux, G., Rogers, R., Ashby, C., Smith, K., Thomas, C., Schetter,
A., Zhou, Q., Cushman, M.A., Tossberg, J., Nickle, T., Levin, J.Z., Law, M., Meinke,
D. y Patton, D. (2001). Insertional mutagenesis of genes required for seed
development in Arabidopsis thaliana. Genetics 159, 1751-63.
McGinnis, W., Levine, M.S., Hafen, E., Kuroiwa, A. y Gehring, W.J. (1984). A
conserved DNA sequence in homoeotic genes of the Drosophila Antennapedia and
bithorax complexes. Nature 308, 428-433.
McHale, N.A. y Koning, R.E. (2004). MicroRNA-directed cleavage of Nicotiana
sylvestris PHAVOLUTA mRNA regulates the vascular cambium and structure of
apical meristems. Plant Cell 16, 1730-1740.
Meakin, P. y Roberts, J. (1990). Dehiscence of fruit in oilseed rape (Brassica napus L.)
I. Anatomy of pod dehiscence. J. Exp. Bot. 41, 995-1002.
Meijer, A.H., Scarpella, E., van Dijk, E.L., Qin, L., Taal, A.J., Rueb, S., Harrington, S.E.,
McCouch, S.R., Schilperoort, R.A. y Hoge, J.H. (1997). Transcriptional repression
by Oshox1, a novel homeodomain leucine zipper protein from rice. Plant J. 11, 263276.
Meinhardt, H. (1982). Models of Biological Pattern Formation, Academic Press,
London.
Meinhardt H. (1984). Models for positional signalling, the threefold subdivision of
segments and the pigmentation pattern of molluscs. J. Embryol. Exp. Morphol. 83,
289-311.
Meinhardt, H. y Gierer, A. (2000). Pattern formation by local self-activation and lateral
inhibition. Bioessays 22, 753-760.
Meinke, D. y Koornneef, M. (1997). Community standards for Arabidopis. Plant J. 12:
247-253.
Meinke, D.W., Cherry, J.M., Dean, C., Rounsley, S.D. y Koornneef, M. (1998).
Arabidopsis thaliana: a model plant for genome analysis. Science 282: 679-682.
Meissner, R. y Theres, K. (1995). Isolation and characterization of the tomato
homeobox gene THOM1. Planta 195, 541-547.
Meyerowitz, E.M. y Pruit, R.E. (1985). Arabidopsis thaliana and plant molecular
Bibliografía 143
genetics. Science 229: 1214-1218.
Meyerowitz, E.M. (1987). Arabidopsis thaliana. Annu. Rev. Genet. 21: 93-111.
Meyerowitz, E.M. (1989). Arabidopsis, a useful weed. Cell 56: 263-269.
Meyerowitz, E.M., Bowman, J.L., Brockman, L.L., Drews, G.N., Jack, T., Lieburth, L.E.
y Weigel, D. (1991). A genetic and molecular model for flower development in
Arabidopsis thaliana. Dev. Suppl. 1, 157-167.
Meyerowitz, E.M. (1994). Pattern formation in plant development: four vignettes. Curr.
Opin. Genet. Dev. 4, 602-608.
Meyerowitz, E.M. y Somerville, C.R. (1994). Arabidopsis. Cold Spring Harbor
Laboratory Press. Nueva York.
Meyerowitz, E.M. (2001). Prehistory and history of Arabidopsis research. Plant Physiol.
125: 15-19.
Mizukami, Y. y Ma, H. (1995). Separation of AG function in floral meristem determinacy
from that in reproductive organ identity by expressing antisense AG RNA. Plant Mol.
Biol. 28, 767-784.
Mouradov, A., Cremer, F. y Coupland, G. (2002). Control of flowering time: interacting
pathways as a basis for diversity. Plant Cell 14: 111-130.
Moussian, B., Schoof, H., Haecker, A., Jurgens, G. y Laux, T. (1998). Role of the
ZWILLE gene in the regulation of central shoot meristem cell fate during Arabidopsis
embryogenesis. EMBO J. 17, 1799-809.
Mozo, T., Fischer, S., Shizuya, H. y Altmann, T. (1998). Construction and
characterization of the IGF Arabidopsis BAC library. Mol. Gen. Genet. 258, 562-570.
Mullis, K., Faloona, F., Scharf, S., Saiki, R., Horn, G. y Erlich, H. (1986). Specific
enzymatic amplification of DNA in vitro: the polymerase chain reaction. Cold Spring
Harb. Symp. Quant. Biol. 51, 263-273.
Newman, K.L., Fernandez, A.G. y Barton, M.K. (2002). Regulation of axis determinacy
by the Arabidopsis PINHEAD gene. Plant Cell 14, 3029-3042.
Ogas, J., Cheng, J.C., Sung, Z.R. y Somerville, C. (1997). Cellular differentiation
regulated by gibberellin in the Arabidopsis thaliana pickle mutant. Science 277, 9194.
Ogas, J., Kaufmann, S., Henderson, J. y Somerville, C. (1999). PICKLE is a CHD3
chromatin-remodeling factor that regulates the transition from embryonic to
vegetative development in Arabidopsis. Proc. Natl. Acad. Sci. USA 96, 1383913844.
Ohashi-Ito, K., Demura, T. y Fukuda, H. (2002). Promotion transcript accumulation of
novel
Zinnia
inmature
xylem-specific
HD-Zip
brassinosteroids. Plant Cell Physiol. 43, 1146-1153.
III
homeobox
genes
by
Bibliografía 144
Ohashi-Ito, K. y Fukuda, H. (2003). HD-zip III homeobox genes that include a novel
member, ZeHB-13 (Zinnia)/ATHB-15 (Arabidopsis), are involved in procambium and
xylem cell differentiation. Plant Cell Physiol. 44, 1350-1358.
Okamuro, J. K., Den Boer, B. G. W., Lotys-Prass, C., Szeto, W. y Jofuku, K. D. (1996).
Flowers into shoots: photo and hormonal control of a meristem identity switch in
Arabidopsis. Proc. Natl. Acad. Sci. USA 93, 13831-13836.
Otsuga, D., DeGuzman, B., Prigge, M.J., Drews, G.N. y Clark, S.E. (2001).
REVOLUTA regulates meristem initiation at lateral positions. Plant J. 25, 223-236.
Page, D.R. y Grossniklaus, U. (2002). The art and design of genetic screens:
Arabidopsis thaliana. Nat. Rev. Genet. 3: 124-136.
Palatnik, J.F., Allen, E., Wu, X., Schommer, C., Schwab, R., Carrington, J.C. y Weigel,
D. (2003). Control of leaf morphogenesis by miRNAs. Nature 425, 257-263.
Paniagua R. (2002). Citología e Histología vegetal y animal. 3ª Edición. Ed. McGrawHill.
Park, W., Li, J., Song, R., Messing, J. y Chen, X. (2002). CARPEL FACTORY, a Dicer
homolog, and HEN1, a novel protein, act in microRNA metabolism in Arabidopsis
thaliana. Curr Biol. 12, 1484-95.
Park, M.Y., Wu, G., Gonzalez-Sulser, A., Vaucheret, H. y Poethig, R.S. (2005). Nuclear
processing and export of microRNAs in Arabidopsis. Proc. Natl. Acad. Sci. USA
102, 3691-3696.
Parker, G., Schofield, R., Sundberg, B. y Turner, S. (2003). Isolation of COV1, a gene
involved in the regulation of vascular patterning in the stem of Arabidopsis.
Development. 130, 2139-2148.
Pearson, W.R. (1994). Using the FASTA program to search protein and DNA sequence
databases. Methods Mol. Biol. 24, 307-331.
Pelaz, S., Ditta, G.S., Baumann, E., Wisman, E. y Yanofsky, M.F. (2000). B and C
floral organ identity functions require SEPALLATA MADS-box genes. Nature 405,
200–203.
Pelaz, S., Gustafson-Brown, C., Kohalmi, S.E., Crosby, W.L. y Yanofsky, M.F. (2001).
APETALA1 and SEPALLATA3 interact to promote flower development. Plant J. 26,
385-394.
Pérez Pérez, J. M. (2003). Caracterización genética y molecular de los mutantes
ultracurvata de Arabidopsis thaliana. Tesis Doctoral. Universidad Miguel Hernández.
Pinyopich, A., Ditta, G.S., Savidge, B., Liljegren, S.J., Baumann, E., Wisman, E. y
Yanofsky, M.F. (2003). Assessing the redundancy of MADS-box genes during
carpel and ovule development. Nature 424, 85–88.
Pogany, J.A., Simon, E.J., Katzman, R.B., de Guzman, B.M., Yu, L.P., Trotochaud,
Bibliografía 145
A.E. y Clark, S.E. (1998). Identifying novel regulators of shoot meristem
development. J. Plant Res. 111, 307-313.
Ponting, C.P. y Aravind, L. (1999). START: a lipid-binding domain in StAR, HD-ZIP and
signalling proteins. Trends Biochem. Sci. 24, 130-132.
Pouteau, S., Nicholls, D., Tooke, F., Coen, E. S y Battey, N. (1997). The induction and
maintenance of flowering in Impatiens. Development 124, 3343-3351.
Prigge, M.J., Otsuga, D., Alonso, J.M., Ecker, J.R., Drews, G.N. y Clark, S.E. (2005).
Class III Homeodomain-Leucine Zipper Gene Family Members Have Overlapping,
Antagonistic, and Distinct Roles in Arabidopsis Development. Plant Cell 17, 61-76.
Pruitt, R.E y Meyerowitz, E.M. (1986). Characterization of the genome of Arabidopsis
thaliana. J. Mol. Biol. 187: 169-183.
Rajani, S. y Sundaresan, V. (2001). The Arabidopsis myc/bHLH gene ALCATRAZ
enables cell separation in fruit dehiscence. Current Biol. 11, 1914-1922.
Ratcliffe, O.J., Riechmann, J.L. y Zhang, J.Z. (2000). INTERFASCICULAR
FIBERLESS1 is the same gene as REVOLUTA. Plant Cell 12, 315-317.
Rédei, G.P. (1965). Non-mendelian megagametogenesis in Arabidopsis. Genetics 51,
857–872.
Rédei, G.P. (1970). Arabidopsis thaliana (L.) Heynh. A review of the genetics and
biology. Bibliogr. Genet. 20, 1-151.
Reinhardt, D., Mandel, T. y Kuhlemeier, C. (2000). Auxin regulates the initiation and
radial position of plant lateral organs. Plant Cell 12, 507-518.
Reinhart, B.J., Weinstein, E.G., Rhoades, M.W., Bartel, B. y Bartel, D.P. (2002).
miRNAs in plants. Genes Dev. 16, 1616-1626.
Reinhardt, D., Pesce, E.R., Stieger, P., Mandel, T., Baltensperger, K., Bennett, M.,
Traas, J., Friml, J. y Kuhlemeier, C. (2003). Regulation of phyllotaxis by polar auxin
transport. Nature 426, 255-260.
Rerie, W.G., Feldmann, K.A. y Marks, M.D. (1994). The GLABRA2 gene encodes a
homeo domain protein required for normal trichome development in Arabidopsis.
Genes Dev. 15, 1388-1399.
Rhoades, M.W., Reinhart, B.J., Lim, L.P., Burge, C.B., Bartel, B. y Bartel, D.P. (2002).
Prediction of plant miRNA targets. Cell 110, 513-520.
Riechmann, J.L. y Meyerowitz, E.M. (1998). The AP2/EREBP family of plant
transcription factors. Biol. Chem. 379, 633-646.
Ripoll Samper, J.J. (2004). Análisis genético y molecular de PEP1, un gen implicado
en la morfogénesis del fruto de Arabidopsis thaliana. Tesis Doctoral. Universidad
Miguel Hernández.
Robinson-Beers, K., Pruitt ,R.E. y Gasser, C.S. (1992). Ovule Development in Wild-
Bibliografía 146
Type Arabidopsis and Two Female-Sterile Mutants. Plant Cell 4,1237-1249.
Robles Ramos, P. (1999). Análisis genético de mutantes de Arabidopsis thaliana con
alteraciones en la morfología de la hoja. Tesis Doctoral. Universidad Miguel
Hernández.
Rodríguez-Tome, P. (2001). EBI databases and services. Mol. Biotech. 18, 199-212.
Roe, J.L., Rivin, C.J., Sessions, R.A., Feldmann, K.A. y Zambryski, P.C. (1993). The
Tousled gene in A. thaliana encodes a protein kinase homolog that is required for
leaf and flower development. Cell 75, 939-950.
Roe, J.L., Durfee, T., Zupan, J.R., Repetti, P.P., McLean, B.G. y Zambryski, P.C.
(1997a) TOUSLED is a nuclear serine/threonine protein kinase that requires a
coiled-coil region for oligomerization and catalytic activity. J Biol Chem. 272, 58385845.
Roe, J.L., Nemhauser, J.L. y Zambryski, P.C. (1997b). TOUSLED participates in apical
tissue formation during gynoecium development in Arabidopsis. Plant Cell 9: 335353.
Roeder, A.H., Ferrándiz, C. y Yanofsky, M.F. (2003). The role of the REPLUMLESS
homeodomain protein in patterning the Arabidopsis fruit. Curr. Biol. 13, 1630-1635.
Rojo, E., Sharma, V.K., Kovaleva, V., Raikhel, N.V. y Fletcher, J.C. (2002). CLV3 is
localized to the extracellular space, where it activates the Arabidopsis CLAVATA
stem cell signaling pathway. Plant Cell 14, 969-977.
Rosso, M.G., Li, Y., Strizhov, N., Reiss, B., Dekker, K. y Weisshaar, B. (2003). An
Arabidopsis thaliana T-DNA mutagenized population (GABI-Kat) for flanking
sequence tag-based reverse genetics. Plant Mol Biol. 53, 247-259.
Ruberti, I., Sessa, G., Lucchetti, S. y Morelli, G. (1991). A novel class of plant proteins
containing a homeodomain with a closely linked leucine zipper motif. EMBO J. 10,
1787-1791.
Sachs, T. (1981). The control of the patterned differentiation of vascular tissues. Adv.
Bot. Res. 9, 151-262.
Sachs, T. (1991). The canalisation of vascular differentiation. In Pattern formation in
plant tissues. pp. 70-87. Cambridge: Cambridge University Press.
Sakakibara, K., Nishiyama, T., Kato, M. y Hasebe, M. (2001). Isolation of
homeodomain-leucine zipper genes from the moss Physcomitrella patens and the
evolution of homeodomain-leucine zipper genes in land plants. Mol Biol Evol. 18,
491-502.
Sambrook, J. y Russell D.W. (2001) Molecular cloning: a laboratory manual. 3ª
Edición. Cold Spring Harbor Laboratory, N. Y.
Sawa, S., Ito, T., Shimura, Y. y Okada, K. (1999a). FILAMENTOUS FLOWER controls
Bibliografía 147
the formation and development of arabidopsis inflorescences and floral meristems.
Plant Cell 11, 69-86.
Sawa, S., Watanabe, K., Goto, K., Liu, Y.G., Shibata, D., Kanaya, E., Morita, E.H. y
Okada, K. (1999b). FILAMENTOUS FLOWER, a meristem and organ identity gene
of Arabidopsis, encodes a protein with a zinc finger and HMG-related domains.
Genes Dev. 13, 1079-1088.
Schena, M. y Davis, R.W. (1992). HD-Zip proteins: members of an Arabidopsis
homeodomain protein superfamily. Proc Natl Acad Sci U S A 89, 3894-3898.
Schrick, K., Nguyen, D., Karlowski, W.M. y Mayer, K.F. (2004). START lipid/sterolbinding domains are amplified in plants and are predominantly associated with
homeodomain transcription factors. Genome Biol. 5, R41.
Schultz, E.A. y Haughn, G.W. (1991). LEAFY, a homeotic gene that regulates
inflorescence development in Arabidopsis. Plant Cell 3, 771-781.
Scott, M.P. y Weiner, A.J. (1984). Structural relationships among genes that control
development: sequence homology between the Antennapedia, Ultrabithorax and
fushi tarazu loci and Drosophila. Proc. Natl. Acad. Sci. USA 81, 4115-4119.
Seki M, Carninci P, Nishiyama Y, Hayashizaki Y y Shinozaki K. (1998). High-efficiency
cloning of Arabidopsis full-length cDNA by biotinylated CAP trapper. Plant J. 15,
707-720.
Seki, M., Narusaka, M., Kamiya, A., Ishida, J., Satou, M., Sakurai, T., Nakajima, M.,
Enju, A., Akiyama, K., Oono, Y., Muramatsu, M., Hayashizaki, Y., Kawai, J.,
Carninci, P., Itoh, M., Ishii, Y., Arakawa, T., Shibata, K., Shinagawa, A. y Shinozaki,
K. (2002). Functional annotation of a full-length Arabidopsis cDNA collection.
Science 296, 141-145
Semiarti, E., Ueno, Y., Tsukaya, H., Iwakawa, H., Machida, C. y Machida, Y. (2001).
The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana regulates formation of a
symmetric lamina, establishment of venation and repression of meristem-related
homeobox genes in leaves. Development 128, 1771-1783.
Serrano-Cartagena, J., Robles, P., Ponce, M.R. y Micol, J.L. (1999). Genetic analysis
of leaf form mutants from the Arabidopsis Information Service collection. Mol. Gen.
Genet. 261, 725-739.
Serrano-Cartagena, J., Candela, H., Robles, P., Ponce, M.R., Pérez-Pérez, J.M.,
Piqueras, P. y Micol, J.L. (2000). Genetic analysis of incurvata mutants reveals
three independent genetic operations at work in Arabidopsis leaf morphogenesis.
Genetics 156, 1363-1377.
Sessa, G., Morelli, G. y Ruberti, I. (1993). The Athb-1 and -2 HD-Zip domains
homodimerize forming complexes of different DNA binding specificities. EMBO J.
Bibliografía 148
12, 3507-3517.
Sessa, G., Cabarelli, M., Ruberti, I., Lucchetti, S., Baima, S. y Morelli, G. (1994).
Identification of distinct families of HD-ZIP proteins in Arabidopsis thaliana. En
Molecular-Genetic analysis of Plant Development and Metabolism, Springer Verlag,
Berlin, 411-426.
Sessa, G., Steindler, C., Morelli, G. y Ruberti, I. (1998). The Arabidopsis Athb-8, -9 and
-14 genes are members of a small gene family coding for highly related HD-ZIP
proteins. Plant Mol Biol. 38, 609-622.
Sessions, A. y Zambryski, P.C. (1995). Arabidopsis gynoecium structure in the wild
type and in ettin mutants. Development 121, 1519-1532.
Sessions, A., Nemhauser, J.L., McCall, A., Roe, J.L., Feldmann, K.A. y Zambryski,
P.C. (1997). ETTIN patterns the Arabidopsis floral meristem and reproductive
organs. Development 124, 4481-4491.
Shin, D., Koo, Y.D., Lee, J., Lee, H.J., Baek, D., Lee, S., Cheon, C.I., Kwak, S.S., Lee,
S.Y. y Yun, D.J. (2004). Athb-12, a homeobox-leucine zipper domain protein from
Arabidopsis thaliana, increases salt tolerance in yeast by regulating sodium
exclusion. Biochem. Biophys. Res. Commun. 323, 534-540.
Shpak, E.D., Lakeman, M.B. y Torii, K.U. (2003). Dominant negative receptor uncovers
redundancy in the Arabidopsis ERECTA Leucine-rich repeat receptor-like kinase
signaling pathway that regulates organ shape. Plant Cell 15, 1095–1110.
Siegfried, K.R., Eshed, Y., Baum, S.F., Otsuga, D., Drews, G.N. y Bowman, J.L.
(1999). Members of the YABBY gene family specify abaxial cell fate in Arabidopsis.
Development 126, 4117-4128.
Simpson, G.G. y Dean, C. (2002). Arabidopsis, the Rosetta stone of flowering time?
Science 296, 285-289.
Smith, L.G., Greene, B., Veit, B. y Hake, S. (1992). A dominant mutation in the maize
homeobox gene, Knotted-1, causes its ectopic expression in leaf cells with altered
fates. Development 116, 21-30.
Smith, H.M. y Hake, S. (2003). The interaction of two homeobox genes,
BREVIPEDICELLUS and PENNYWISE, regulates internode patterning in the
Arabidopsis inflorescence. Plant Cell 15, 1717-1727.
Smith, H.M., Campbell, B.C. y Hake, S. (2004). Competence to respond to floral
inductive signals requires the homeobox genes PENNYWISE and POUNDFOOLISH. Curr Biol. 14, 812-817.
Smyth, D.R., Bowman, J.L. y Meyerowitz, E.M. (1990). Early flower development in
Arabidopsis. Plant Cell 2, 755-767.
Söderman, E., Mattsson, J. y Engstrom, P. (1996). The Arabidopsis homeobox gene
Bibliografía 149
ATHB-7 is induced by water deficit and by abscisic acid. Plant J. 10, 375-381.
Söderman, E., Hjellstrom, M., Fahleson, J. y Engstrom, P. (1999). The HD-Zip gene
ATHB-6 in Arabidopsis is expressed in developing leaves, roots and carpels and upregulated by water deficit conditions. Plant Mol. Biol. 40, 1073-1083.
Somerville, C. y Koornneef, M. (2002). A fortunate choice: the history of Arabidopsis as
a model plant. Nat. Rev. Genet. 3: 883-889.
Spence, J., Vercher, Y., Gates, P. y Harris, N. (1996). `Pod shatter' in Arabidopsis
thaliana, Brassica napus and B. juncea. J. Microsc. 181, 195-203.
Steeves, T.A. y Sussex, I.M. (1989). Patterns in Plant Development. Cambridge Univ.
Press UK.
Steindler, C., Matteucci, A., Sessa, G., Weimar, T., Ohgishi, M., Aoyama, T., Morelli, G.
y Ruberti, I. (1999). Shade avoidance responses are mediated by the ATHB-2 HDzip protein, a negative regulator of gene expression. Development 126, 4235-4245.
Steinmann, T., Geldner, N., Grebe, M., Mangold, S., Jackson, C. L., Paris, S.,
Galweiler, L., Palme, K. y Jürgens, G. (1999). Coordinated polar localization of auxin
efflux carrier PIN1 by GNOM ARF GEF. Science 286, 316-318.
Strizhov, N., Li, Y., Rosso, M.G., Viehoever, P., Dekker, K.A. y Weisshaar, B. (2003).
High-throughput generation of sequence indexes from T-DNA mutagenized
Arabidopsis thaliana lines. Biotechniques 35, 1164-1168.
Strasburger, E., Noll, F., Schenck, H. y Schimper, A.F.W. (1994). Tratado de Botánica.
8ª Edición. Editorial Omega.
Sun, Y., Zhou, Q., Zhang, W., Fu, Y. y Huang, H. (2002). ASYMMETRIC LEAVES1, an
Arabidopsis gene that is involved in the control of cell differentiation in leaves.
Planta 214, 694-702.
Sussex, I.M. (1954). Experiments on the cause of dorsiventrality in leaves. Nature 174,
351-352.
Sussex, I.M. (1955). Morphogenesis in Solanum tuberosum L: experimental
investigation of leaf dorsiventrality and orientation in the juvenile shoot.
Phytomorphology 5, 286-300.
Talbert, P.B., Adler, H.T., Parks, D.W. y Comai, L. (1995). The REVOLUTA gene is
necessary for apical meristem development and for limiting cell divisions in the
leaves and stems of Arabidopsis thaliana. Development 121, 2723-2735.
Tang, G., Reinhart, B.J., Bartel, D.P. y Zamore, P.D. (2003). A biochemical framework
for RNA silencing in plants. Genes Dev. 17, 49-63.
Tasaka M. (2001). From central-peripheral to adaxial-abaxial. Trends Plant Sci. 6, 548550.
Tatusova, T.A. y Madden, T.L. (1999). BLAST 2 Sequences, a new tool for comparing
Bibliografía 150
protein and nucleotide sequences. FEMS Microbiol. Lett. 174, 1577-1588.
Taylor, C.B. (1997). Plant vegetative development: from seed and embryo to shoot and
root. Plant Cell 9, 981-988.
Telfer, A. y Poethig, R.S. (1994). Leaf development in Arabidopsis. En Arabidopsis,
pp.379-400. Meyerowitz, E.M. y Somerville, C.R. (eds.). Cold Spring Harbor
Laboratory Press, NY.
Telfer, A., Bollman, K.M. y Poethig, R.S. (1997). Phase change and the regulation of
trichome distribution in Arabidopsis thaliana. Development 124, 645-654.
Telfer, A. y Poethig, R.S. (1998). HASTY: a gene that regulates the timing of shoot
maturation in Arabidopsis thaliana. Development 125, 1889-1898.
The Arabidopsis Genome Initiative (2000). Analysis genome sequence of the flowering
plant Arabidopsis thaliana. Nature 408, 796-815.
The Caenorhabditis elegans Sequencing Consortium. (1998). Genome sequence of
the nematode C. elegans: a platform for investigating biology. Science 282, 20122018.
Thompson, J.D., Higgins, D.G. y Gibson, T.J. (1994). CLUSTAL W: Improving the
sensitivity of progressive multiple sequence alignment through sequence weighting,
position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22,
4673-4680.
Thompson, J.D., Gibson, T.J., Plewniak, F., Jeanmougin, F. y Higgins, D. G. (1997).
The CLUSTAL-X windows interface: flexible strategies fro multiple sequence
alignment aided by quality analysis tools. Nucleic Acids Res. 25, 4876-4882.
Timpte, C., Wilson, A.K. y Estelle, M. (1994). The axr2-1 mutation of Arabidopsis
thaliana is a gain-of-function mutation that disrupts an early step in auxin response.
Genetics 138, 1239-1249.
Topping, J.F. y Lindsey K. (1997). Promoter trap markers differentiate structural and
positional components of polar development in Arabidopsis. Plant Cell 9, 17131725.
Trotochaud, A.E, Hao, T., Wu, G., Yang, Z. y Clark, S. E. (1999) The CLAVATA1
receptor-like kinase requires CLAVATA3 for its assembly into a signaling complex
that includes KAPP and a Rho-related protein. Plant Cel 11, 393-406.
Turner, S. y Sieburth, L.E. (2002). Vascular patterning. En The Arabidopsis Book.
Somerville, C.R. y Meyerowitz, E.M. (eds.), American Society of Plant Biologists,
Rockville, MD.
Vaucheret, H., Vazquez, F., Crete, P. y Bartel, D.P. (2004). The action of
ARGONAUTE1 in the miRNA pathway and its regulation by the miRNA pathway are
crucial for plant development. Genes Dev. 18, 1187-1197.
Bibliografía 151
Venglat, S.P., Dumonceaux, T., Rozwadowski, K., Parnell, L., Babic, V., Keller, W.,
Martienssen, R., Selvaraj, G. y Datla, R. (2002). The homeobox gene
BREVIPEDICELLUS is a key regulator of inflorescence architecture in Arabidopsis.
Proc. Natl. Acad. Sci. U S A 99, 4730-4735.
Vernoux, T., Kronenberger, J., Grandjean, O., Laufs, P. y Traas J. (2000). PINFORMED 1 regulates cell fate at the periphery of the shoot apical meristem.
Development 127, 5157-5165.
Villanueva, J.M., Broadhvest, J., Hauser, B.A., Meister, R.J., Schneitz, K. y Gasser,
C.S. (1999). INNER NO OUTER regulates abaxial- adaxial patterning in Arabidopsis
ovules. Genes Dev. 13, 3160-3169.
Vollbrecht, E., Veit, B., Sinha, N. y Hake, S. (1991). The developmental gene Knotted-1
is a member of a maize homeobox gene family. Nature 350, 241-3.
Waites, R. y Hudson, A. (1995). phantastica: a gene required for dorsoventrality in
leaves of Antirrhinum majus. Development 121, 2143-2154.
Waites, R. y Hudson, A. (2001). The Handlebars gene is required with Phantastica for
dorsoventral asymmetry of organs and for stem cell activity in Antirrhinum.
Development 128, 1923-1931.
Washburn, C.F. y Thomas J.F. (2000). Reversion of flowering in Glycine max
(Fabaceae). Am. J. Bot. 87, 1425-1438.
Weberling, F. (1989). Morphology of Flowers and Inflorescences. Cambridge:
Cambridge University Press.
Weigel, D., Álvarez, J., Smyth, D.R., Yanofsky, M.F. y Meyerowitz, E.M. (1992). LEAFY
controls floral meristem identity in Arabidopsis. Cell 69, 843-859.
Weigel, D. y Meyerowitz, E.M. (1994). The ABCs of floral homeotic genes. Cell 78,
203-209.
Weigel, D., Ahn, J.H., Blázquez, M.A., Borevitz, J.O., Christensen, S.K., Fankhauser,
C., Ferrándiz, C., Kardailsky, I., Malancharuvil, E.J., Neff, M.M., Nguyen, J.T., Sato,
S., Wang, Z.Y., Xia, Y., Dixon, R.A., Harrison, M.J., Lamb, C.J., Yanofsky, M.F. y
Chory, J. (2000). Activation tagging in Arabidopsis. Plant Physiol. 122, 1003–1013.
Weigel, D. y Glazebrook, J. (2002). Arabidopsis: A laboratory manual. Cold spring
Harbor Laboratory press, Cold spring harbor, New York, pp.19-39.
White, J. (1984). Plant metamerism. En Perspectives In Plant Population Ecology. R.
Dirzo y J. Sarukhan (eds.), pp. 15-47. Sunderland, MA: Sinauer Associates Inc.
Wilson, K., Long, D., Swinburne, J. y Coupland, G. (1996). A Dissociation insertion
causes a semidominant mutation that increases expression of TINY, an Arabidopsis
gene related to APETALA2. Plant Cell 8, 659–671.
Wolpert, L., Beddington, R., Jessell, T., Lawrence, P., Meyerowitz, E.M. y Smith, J.
Bibliografía 152
(2002). Principles of development. 2ª Edición. Oxford University Press.
Wysocka-Diller, J.W., Helariutta, Y., Fukaki, H., Malamy, J.E. y Benfey, P.N. (2000).
Molecular analysis of SCARECROW function reveals a radial patterning mechanism
common to root and shoot. Development 127, 595-603.
Xu, L., Xu, Y., Dong, A., Sun, Y., Pi, L., Xu, Y. y Huang, H. (2003). Novel as1 and as2
defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC
LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.
Development 130, 4097-4107.
Yanofsky, M.F., Ma, H., Bowman J.L., Drews, G.N., Feldmann, K.A. y Meyerowitz,
E.M. (1990). The protein encoded by the Arabidopsis homeotic gene AGAMOUS
resembles transcription factors. Nature 346, 35-39.
Ye, Z. (2002). Vascular differentiation and pattern formation in plants. Annu. Rev. Plant
Biol. 53, 183-202.
Ye, Z.H., Freshour, G., Hahn, M.G., Burk, D.H. y Zhong, R. (2002). Vascular
development in Arabidopsis. Int. Rev. Cytol. 220, 225-56.
Yi, R., Qin, Y., Macara, I.G. y Cullen, B.R. (2003). Exportin-5 mediates the nuclear
export of pre-microRNAs and short hairpin RNAs. Genes Dev. 17, 3011-3016.
Young, B.S. (1953). The effects of leaf primordia on differentiation in the stem. New
Phytol. 53, 445-460.
Yu, L., Yu, X., Shen, R. y He, Y. (2005). HYL1 gene maintains venation and polarity of
leaves. Planta 221, 231-242.
Zambryski, P.C., Joos, H., Genetello, C., Lesmansm, J., Van Montagu, M. y Scheel, J.
(1983). Ti plasmid vector for the introduction of DNA into plant cells without
alteration of their normal regeneration capacity. EMBO J. 2, 2143-2150.
Zeng, Y. y Cullen, B.R. (2004). Structural requirements for pre-microRNA binding and
nuclear export by Exportin 5. Nucleic Acids Res. 32, 4776-4785.
Zhong, R., Taylor, J.J. y Ye, Z.H. (1999). amphivasal vascular bundles in an
Arabidopsis mutant. Plant Physiol. 120, 53-64
Zhong, R. y Ye, Z.H. (1999). IFL1, a gene regulating interfascicular fiber differentiation
in Arabidopsis, encodes a homeodomain-leucine zipper protein. Plant Cell 11, 21392152
Zhong, R. y Ye, Z.H. (2001). Alteration of auxin polar transport in the Arabidopsis ifl1
mutants. Plant Physiol. 126, 549-563.
Zhong, R. y Ye, Z.H. (2004). amphivasal vascular bundle 1, a gain-of-function mutation
of the IFL1/REV gene, is associated with alterations in the polarity of leaves, stems
and carpels. Plant Cell Physiol. 45, 369-385.
Zik, M. y Irish, V.F. (2003). Flower development: initiation, differentiation, and
Bibliografía 153
diversification. Annu. Rev. Cell Dev. Biol. 19,119-140.
Zimmermann, W. (1952). The main results of the telome theory. Palaeobotanist 1, 456470.
Agradecimientos 156
Agradecimientos
A Antonio Martínez Laborda, por su labor de dirección y su inestimable apoyo
siempre que lo he necesitado.
A Antonio Vera, por sus valiosos comentarios acerca de este trabajo.
A Juan José Ripoll, de cuya Tesis se han tomado algunos apartados de
Materiales y Métodos, por prestarme sus conocimientos durante mis primeros pasos
en el laboratorio.
A Juan José Ripoll y Hugo Alonso, por su ayuda y su amistad, y por los
buenos momentos que hemos pasado durante estos últimos años.
A Adelaida Baso y Asunción Climent, por su inestimable ayuda técnica.
A José Luis Micol y sus colaboradores, por prestarme su ayuda siempre que
la he necesitado.
A mi familia, por su apoyo incondicional.
A Miguel, por animarme siempre a seguir adelante.
La realización de esta Tesis ha sido posible gracias a la concesión de una
beca predoctoral de la Conselleria d’Empresa, Universitat i Ciència de la Generalitat
Valenciana.